diff --git a/README.md b/README.md index ea02615980..1d10617dba 100644 --- a/README.md +++ b/README.md @@ -300,6 +300,7 @@ Current number of checkpoints: ![](https://img.shields.io/endpoint?url=https://h 1. **[ELECTRA](https://huggingface.co/docs/transformers/model_doc/electra)** (from Google Research/Stanford University) released with the paper [ELECTRA: Pre-training text encoders as discriminators rather than generators](https://arxiv.org/abs/2003.10555) by Kevin Clark, Minh-Thang Luong, Quoc V. Le, Christopher D. Manning. 1. **[EncoderDecoder](https://huggingface.co/docs/transformers/model_doc/encoder-decoder)** (from Google Research) released with the paper [Leveraging Pre-trained Checkpoints for Sequence Generation Tasks](https://arxiv.org/abs/1907.12461) by Sascha Rothe, Shashi Narayan, Aliaksei Severyn. 1. **[ERNIE](https://huggingface.co/docs/transformers/model_doc/ernie)** (from Baidu) released with the paper [ERNIE: Enhanced Representation through Knowledge Integration](https://arxiv.org/abs/1904.09223) by Yu Sun, Shuohuan Wang, Yukun Li, Shikun Feng, Xuyi Chen, Han Zhang, Xin Tian, Danxiang Zhu, Hao Tian, Hua Wu. +1. **[ESM](https://huggingface.co/docs/transformers/main/model_doc/esm)** (from Meta AI) are transformer protein language models. **ESM-1b** was released with the paper [Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences](https://www.pnas.org/content/118/15/e2016239118) by Alexander Rives, Joshua Meier, Tom Sercu, Siddharth Goyal, Zeming Lin, Jason Liu, Demi Guo, Myle Ott, C. Lawrence Zitnick, Jerry Ma, and Rob Fergus. **ESM-1v** was released with the paper [Language models enable zero-shot prediction of the effects of mutations on protein function](https://doi.org/10.1101/2021.07.09.450648) by Joshua Meier, Roshan Rao, Robert Verkuil, Jason Liu, Tom Sercu and Alexander Rives. **ESM-2** was released with the paper [Language models of protein sequences at the scale of evolution enable accurate structure prediction](https://doi.org/10.1101/2022.07.20.500902) by Zeming Lin, Halil Akin, Roshan Rao, Brian Hie, Zhongkai Zhu, Wenting Lu, Allan dos Santos Costa, Maryam Fazel-Zarandi, Tom Sercu, Sal Candido, Alexander Rives. 1. **[FlauBERT](https://huggingface.co/docs/transformers/model_doc/flaubert)** (from CNRS) released with the paper [FlauBERT: Unsupervised Language Model Pre-training for French](https://arxiv.org/abs/1912.05372) by Hang Le, Loïc Vial, Jibril Frej, Vincent Segonne, Maximin Coavoux, Benjamin Lecouteux, Alexandre Allauzen, Benoît Crabbé, Laurent Besacier, Didier Schwab. 1. **[FLAVA](https://huggingface.co/docs/transformers/model_doc/flava)** (from Facebook AI) released with the paper [FLAVA: A Foundational Language And Vision Alignment Model](https://arxiv.org/abs/2112.04482) by Amanpreet Singh, Ronghang Hu, Vedanuj Goswami, Guillaume Couairon, Wojciech Galuba, Marcus Rohrbach, and Douwe Kiela. 1. **[FNet](https://huggingface.co/docs/transformers/model_doc/fnet)** (from Google Research) released with the paper [FNet: Mixing Tokens with Fourier Transforms](https://arxiv.org/abs/2105.03824) by James Lee-Thorp, Joshua Ainslie, Ilya Eckstein, Santiago Ontanon. diff --git a/README_ko.md b/README_ko.md index e7a0d9d296..ca21d265f2 100644 --- a/README_ko.md +++ b/README_ko.md @@ -250,6 +250,7 @@ Flax, PyTorch, TensorFlow 설치 페이지에서 이들을 conda로 설치하는 1. **[ELECTRA](https://huggingface.co/docs/transformers/model_doc/electra)** (from Google Research/Stanford University) released with the paper [ELECTRA: Pre-training text encoders as discriminators rather than generators](https://arxiv.org/abs/2003.10555) by Kevin Clark, Minh-Thang Luong, Quoc V. Le, Christopher D. Manning. 1. **[EncoderDecoder](https://huggingface.co/docs/transformers/model_doc/encoder-decoder)** (from Google Research) released with the paper [Leveraging Pre-trained Checkpoints for Sequence Generation Tasks](https://arxiv.org/abs/1907.12461) by Sascha Rothe, Shashi Narayan, Aliaksei Severyn. 1. **[ERNIE](https://huggingface.co/docs/transformers/model_doc/ernie)** (from Baidu) released with the paper [ERNIE: Enhanced Representation through Knowledge Integration](https://arxiv.org/abs/1904.09223) by Yu Sun, Shuohuan Wang, Yukun Li, Shikun Feng, Xuyi Chen, Han Zhang, Xin Tian, Danxiang Zhu, Hao Tian, Hua Wu. +1. **[ESM](https://huggingface.co/docs/transformers/main/model_doc/esm)** (from Meta AI) are transformer protein language models. **ESM-1b** was released with the paper [Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences](https://www.pnas.org/content/118/15/e2016239118) by Alexander Rives, Joshua Meier, Tom Sercu, Siddharth Goyal, Zeming Lin, Jason Liu, Demi Guo, Myle Ott, C. Lawrence Zitnick, Jerry Ma, and Rob Fergus. **ESM-1v** was released with the paper [Language models enable zero-shot prediction of the effects of mutations on protein function](https://doi.org/10.1101/2021.07.09.450648) by Joshua Meier, Roshan Rao, Robert Verkuil, Jason Liu, Tom Sercu and Alexander Rives. **ESM-2** was released with the paper [Language models of protein sequences at the scale of evolution enable accurate structure prediction](https://doi.org/10.1101/2022.07.20.500902) by Zeming Lin, Halil Akin, Roshan Rao, Brian Hie, Zhongkai Zhu, Wenting Lu, Allan dos Santos Costa, Maryam Fazel-Zarandi, Tom Sercu, Sal Candido, Alexander Rives. 1. **[FlauBERT](https://huggingface.co/docs/transformers/model_doc/flaubert)** (from CNRS) released with the paper [FlauBERT: Unsupervised Language Model Pre-training for French](https://arxiv.org/abs/1912.05372) by Hang Le, Loïc Vial, Jibril Frej, Vincent Segonne, Maximin Coavoux, Benjamin Lecouteux, Alexandre Allauzen, Benoît Crabbé, Laurent Besacier, Didier Schwab. 1. **[FLAVA](https://huggingface.co/docs/transformers/model_doc/flava)** (from Facebook AI) released with the paper [FLAVA: A Foundational Language And Vision Alignment Model](https://arxiv.org/abs/2112.04482) by Amanpreet Singh, Ronghang Hu, Vedanuj Goswami, Guillaume Couairon, Wojciech Galuba, Marcus Rohrbach, and Douwe Kiela. 1. **[FNet](https://huggingface.co/docs/transformers/model_doc/fnet)** (from Google Research) released with the paper [FNet: Mixing Tokens with Fourier Transforms](https://arxiv.org/abs/2105.03824) by James Lee-Thorp, Joshua Ainslie, Ilya Eckstein, Santiago Ontanon. diff --git a/README_zh-hans.md b/README_zh-hans.md index f3f1a5474c..af39a36967 100644 --- a/README_zh-hans.md +++ b/README_zh-hans.md @@ -274,6 +274,7 @@ conda install -c huggingface transformers 1. **[ELECTRA](https://huggingface.co/docs/transformers/model_doc/electra)** (来自 Google Research/Stanford University) 伴随论文 [ELECTRA: Pre-training text encoders as discriminators rather than generators](https://arxiv.org/abs/2003.10555) 由 Kevin Clark, Minh-Thang Luong, Quoc V. Le, Christopher D. Manning 发布。 1. **[EncoderDecoder](https://huggingface.co/docs/transformers/model_doc/encoder-decoder)** (来自 Google Research) 伴随论文 [Leveraging Pre-trained Checkpoints for Sequence Generation Tasks](https://arxiv.org/abs/1907.12461) 由 Sascha Rothe, Shashi Narayan, Aliaksei Severyn 发布。 1. **[ERNIE](https://huggingface.co/docs/transformers/model_doc/ernie)** (来自 Baidu) 伴随论文 [ERNIE: Enhanced Representation through Knowledge Integration](https://arxiv.org/abs/1904.09223) by Yu Sun, Shuohuan Wang, Yukun Li, Shikun Feng, Xuyi Chen, Han Zhang, Xin Tian, Danxiang Zhu, Hao Tian, Hua Wu 发布。 +1. **[ESM](https://huggingface.co/docs/transformers/main/model_doc/esm)** (from Meta AI) are transformer protein language models. **ESM-1b** was released with the paper [Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences](https://www.pnas.org/content/118/15/e2016239118) by Alexander Rives, Joshua Meier, Tom Sercu, Siddharth Goyal, Zeming Lin, Jason Liu, Demi Guo, Myle Ott, C. Lawrence Zitnick, Jerry Ma, and Rob Fergus. **ESM-1v** was released with the paper [Language models enable zero-shot prediction of the effects of mutations on protein function](https://doi.org/10.1101/2021.07.09.450648) by Joshua Meier, Roshan Rao, Robert Verkuil, Jason Liu, Tom Sercu and Alexander Rives. **ESM-2** was released with the paper [Language models of protein sequences at the scale of evolution enable accurate structure prediction](https://doi.org/10.1101/2022.07.20.500902) by Zeming Lin, Halil Akin, Roshan Rao, Brian Hie, Zhongkai Zhu, Wenting Lu, Allan dos Santos Costa, Maryam Fazel-Zarandi, Tom Sercu, Sal Candido, Alexander Rives. 1. **[FlauBERT](https://huggingface.co/docs/transformers/model_doc/flaubert)** (来自 CNRS) 伴随论文 [FlauBERT: Unsupervised Language Model Pre-training for French](https://arxiv.org/abs/1912.05372) 由 Hang Le, Loïc Vial, Jibril Frej, Vincent Segonne, Maximin Coavoux, Benjamin Lecouteux, Alexandre Allauzen, Benoît Crabbé, Laurent Besacier, Didier Schwab 发布。 1. **[FLAVA](https://huggingface.co/docs/transformers/model_doc/flava)** (来自 Facebook AI) 伴随论文 [FLAVA: A Foundational Language And Vision Alignment Model](https://arxiv.org/abs/2112.04482) 由 Amanpreet Singh, Ronghang Hu, Vedanuj Goswami, Guillaume Couairon, Wojciech Galuba, Marcus Rohrbach, and Douwe Kiela 发布。 1. **[FNet](https://huggingface.co/docs/transformers/model_doc/fnet)** (来自 Google Research) 伴随论文 [FNet: Mixing Tokens with Fourier Transforms](https://arxiv.org/abs/2105.03824) 由 James Lee-Thorp, Joshua Ainslie, Ilya Eckstein, Santiago Ontanon 发布。 diff --git a/README_zh-hant.md b/README_zh-hant.md index 43e8a05372..3a3122af87 100644 --- a/README_zh-hant.md +++ b/README_zh-hant.md @@ -286,6 +286,7 @@ conda install -c huggingface transformers 1. **[ELECTRA](https://huggingface.co/docs/transformers/model_doc/electra)** (from Google Research/Stanford University) released with the paper [ELECTRA: Pre-training text encoders as discriminators rather than generators](https://arxiv.org/abs/2003.10555) by Kevin Clark, Minh-Thang Luong, Quoc V. Le, Christopher D. Manning. 1. **[EncoderDecoder](https://huggingface.co/docs/transformers/model_doc/encoder-decoder)** (from Google Research) released with the paper [Leveraging Pre-trained Checkpoints for Sequence Generation Tasks](https://arxiv.org/abs/1907.12461) by Sascha Rothe, Shashi Narayan, Aliaksei Severyn. 1. **[ERNIE](https://huggingface.co/docs/transformers/model_doc/ernie)** (from Baidu) released with the paper [ERNIE: Enhanced Representation through Knowledge Integration](https://arxiv.org/abs/1904.09223) by Yu Sun, Shuohuan Wang, Yukun Li, Shikun Feng, Xuyi Chen, Han Zhang, Xin Tian, Danxiang Zhu, Hao Tian, Hua Wu. +1. **[ESM](https://huggingface.co/docs/transformers/main/model_doc/esm)** (from Meta AI) are transformer protein language models. **ESM-1b** was released with the paper [Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences](https://www.pnas.org/content/118/15/e2016239118) by Alexander Rives, Joshua Meier, Tom Sercu, Siddharth Goyal, Zeming Lin, Jason Liu, Demi Guo, Myle Ott, C. Lawrence Zitnick, Jerry Ma, and Rob Fergus. **ESM-1v** was released with the paper [Language models enable zero-shot prediction of the effects of mutations on protein function](https://doi.org/10.1101/2021.07.09.450648) by Joshua Meier, Roshan Rao, Robert Verkuil, Jason Liu, Tom Sercu and Alexander Rives. **ESM-2** was released with the paper [Language models of protein sequences at the scale of evolution enable accurate structure prediction](https://doi.org/10.1101/2022.07.20.500902) by Zeming Lin, Halil Akin, Roshan Rao, Brian Hie, Zhongkai Zhu, Wenting Lu, Allan dos Santos Costa, Maryam Fazel-Zarandi, Tom Sercu, Sal Candido, Alexander Rives. 1. **[FlauBERT](https://huggingface.co/docs/transformers/model_doc/flaubert)** (from CNRS) released with the paper [FlauBERT: Unsupervised Language Model Pre-training for French](https://arxiv.org/abs/1912.05372) by Hang Le, Loïc Vial, Jibril Frej, Vincent Segonne, Maximin Coavoux, Benjamin Lecouteux, Alexandre Allauzen, Benoît Crabbé, Laurent Besacier, Didier Schwab. 1. **[FLAVA](https://huggingface.co/docs/transformers/model_doc/flava)** (from Facebook AI) released with the paper [FLAVA: A Foundational Language And Vision Alignment Model](https://arxiv.org/abs/2112.04482) by Amanpreet Singh, Ronghang Hu, Vedanuj Goswami, Guillaume Couairon, Wojciech Galuba, Marcus Rohrbach, and Douwe Kiela. 1. **[FNet](https://huggingface.co/docs/transformers/model_doc/fnet)** (from Google Research) released with the paper [FNet: Mixing Tokens with Fourier Transforms](https://arxiv.org/abs/2105.03824) by James Lee-Thorp, Joshua Ainslie, Ilya Eckstein, Santiago Ontanon. diff --git a/docs/source/en/_toctree.yml b/docs/source/en/_toctree.yml index 644778e155..6e0f764465 100644 --- a/docs/source/en/_toctree.yml +++ b/docs/source/en/_toctree.yml @@ -241,6 +241,8 @@ title: Encoder Decoder Models - local: model_doc/ernie title: ERNIE + - local: model_doc/esm + title: ESM - local: model_doc/flaubert title: FlauBERT - local: model_doc/fnet diff --git a/docs/source/en/index.mdx b/docs/source/en/index.mdx index 652c5bc77b..8b5defb96e 100644 --- a/docs/source/en/index.mdx +++ b/docs/source/en/index.mdx @@ -90,6 +90,7 @@ The documentation is organized into five sections: 1. **[ELECTRA](model_doc/electra)** (from Google Research/Stanford University) released with the paper [ELECTRA: Pre-training text encoders as discriminators rather than generators](https://arxiv.org/abs/2003.10555) by Kevin Clark, Minh-Thang Luong, Quoc V. Le, Christopher D. Manning. 1. **[EncoderDecoder](model_doc/encoder-decoder)** (from Google Research) released with the paper [Leveraging Pre-trained Checkpoints for Sequence Generation Tasks](https://arxiv.org/abs/1907.12461) by Sascha Rothe, Shashi Narayan, Aliaksei Severyn. 1. **[ERNIE](model_doc/ernie)** (from Baidu) released with the paper [ERNIE: Enhanced Representation through Knowledge Integration](https://arxiv.org/abs/1904.09223) by Yu Sun, Shuohuan Wang, Yukun Li, Shikun Feng, Xuyi Chen, Han Zhang, Xin Tian, Danxiang Zhu, Hao Tian, Hua Wu. +1. **[ESM](model_doc/esm)** (from Meta AI) are transformer protein language models. **ESM-1b** was released with the paper [Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences](https://www.pnas.org/content/118/15/e2016239118) by Alexander Rives, Joshua Meier, Tom Sercu, Siddharth Goyal, Zeming Lin, Jason Liu, Demi Guo, Myle Ott, C. Lawrence Zitnick, Jerry Ma, and Rob Fergus. **ESM-1v** was released with the paper [Language models enable zero-shot prediction of the effects of mutations on protein function](https://doi.org/10.1101/2021.07.09.450648) by Joshua Meier, Roshan Rao, Robert Verkuil, Jason Liu, Tom Sercu and Alexander Rives. **ESM-2** was released with the paper [Language models of protein sequences at the scale of evolution enable accurate structure prediction](https://doi.org/10.1101/2022.07.20.500902) by Zeming Lin, Halil Akin, Roshan Rao, Brian Hie, Zhongkai Zhu, Wenting Lu, Allan dos Santos Costa, Maryam Fazel-Zarandi, Tom Sercu, Sal Candido, Alexander Rives. 1. **[FlauBERT](model_doc/flaubert)** (from CNRS) released with the paper [FlauBERT: Unsupervised Language Model Pre-training for French](https://arxiv.org/abs/1912.05372) by Hang Le, Loïc Vial, Jibril Frej, Vincent Segonne, Maximin Coavoux, Benjamin Lecouteux, Alexandre Allauzen, Benoît Crabbé, Laurent Besacier, Didier Schwab. 1. **[FLAVA](model_doc/flava)** (from Facebook AI) released with the paper [FLAVA: A Foundational Language And Vision Alignment Model](https://arxiv.org/abs/2112.04482) by Amanpreet Singh, Ronghang Hu, Vedanuj Goswami, Guillaume Couairon, Wojciech Galuba, Marcus Rohrbach, and Douwe Kiela. 1. **[FNet](model_doc/fnet)** (from Google Research) released with the paper [FNet: Mixing Tokens with Fourier Transforms](https://arxiv.org/abs/2105.03824) by James Lee-Thorp, Joshua Ainslie, Ilya Eckstein, Santiago Ontanon. @@ -239,6 +240,7 @@ Flax), PyTorch, and/or TensorFlow. | ELECTRA | ✅ | ✅ | ✅ | ✅ | ✅ | | Encoder decoder | ❌ | ❌ | ✅ | ✅ | ✅ | | ERNIE | ❌ | ❌ | ✅ | ❌ | ❌ | +| ESM | ✅ | ❌ | ✅ | ❌ | ❌ | | FairSeq Machine-Translation | ✅ | ❌ | ✅ | ❌ | ❌ | | FlauBERT | ✅ | ❌ | ✅ | ✅ | ❌ | | FLAVA | ❌ | ❌ | ✅ | ❌ | ❌ | diff --git a/docs/source/en/model_doc/esm.mdx b/docs/source/en/model_doc/esm.mdx new file mode 100644 index 0000000000..d2fc949781 --- /dev/null +++ b/docs/source/en/model_doc/esm.mdx @@ -0,0 +1,109 @@ + + +# ESM + +## Overview +This page provides code and pre-trained weights for Transformer protein language models from Meta AI's Fundamental +AI Research Team, providing the state-of-the-art ESM-2, and the previously released ESM-1b and ESM-1v. Transformer +protein language models were introduced in the paper [Biological structure and function emerge from scaling +unsupervised learning to 250 million protein sequences](https://www.pnas.org/content/118/15/e2016239118) by +Alexander Rives, Joshua Meier, Tom Sercu, Siddharth Goyal, Zeming Lin, Jason Liu, Demi Guo, Myle Ott, +C. Lawrence Zitnick, Jerry Ma, and Rob Fergus. +The first version of this paper was [preprinted in 2019](https://www.biorxiv.org/content/10.1101/622803v1?versioned=true). + +ESM-2 outperforms all tested single-sequence protein language models across a range of structure prediction tasks, +and enables atomic resolution structure prediction. +It was released with the paper [Language models of protein sequences at the scale of evolution enable accurate +structure prediction](https://doi.org/10.1101/2022.07.20.500902) by Zeming Lin, Halil Akin, Roshan Rao, Brian Hie, +Zhongkai Zhu, Wenting Lu, Allan dos Santos Costa, Maryam Fazel-Zarandi, Tom Sercu, Sal Candido and Alexander Rives. + + +The abstract from +"Biological structure and function emerge from scaling unsupervised learning to 250 +million protein sequences" is + + +*In the field of artificial intelligence, a combination of scale in data and model capacity enabled by unsupervised +learning has led to major advances in representation learning and statistical generation. In the life sciences, the +anticipated growth of sequencing promises unprecedented data on natural sequence diversity. Protein language modeling +at the scale of evolution is a logical step toward predictive and generative artificial intelligence for biology. To +this end, we use unsupervised learning to train a deep contextual language model on 86 billion amino acids across 250 +million protein sequences spanning evolutionary diversity. The resulting model contains information about biological +properties in its representations. The representations are learned from sequence data alone. The learned representation +space has a multiscale organization reflecting structure from the level of biochemical properties of amino acids to +remote homology of proteins. Information about secondary and tertiary structure is encoded in the representations and +can be identified by linear projections. Representation learning produces features that generalize across a range of +applications, enabling state-of-the-art supervised prediction of mutational effect and secondary structure and +improving state-of-the-art features for long-range contact prediction.* + + +The abstract from +"Language models of protein sequences at the scale of evolution enable accurate structure prediction" is + +*Large language models have recently been shown to develop emergent capabilities with scale, going beyond +simple pattern matching to perform higher level reasoning and generate lifelike images and text. While +language models trained on protein sequences have been studied at a smaller scale, little is known about +what they learn about biology as they are scaled up. In this work we train models up to 15 billion parameters, +the largest language models of proteins to be evaluated to date. We find that as models are scaled they learn +information enabling the prediction of the three-dimensional structure of a protein at the resolution of +individual atoms. We present ESMFold for high accuracy end-to-end atomic level structure prediction directly +from the individual sequence of a protein. ESMFold has similar accuracy to AlphaFold2 and RoseTTAFold for +sequences with low perplexity that are well understood by the language model. ESMFold inference is an +order of magnitude faster than AlphaFold2, enabling exploration of the structural space of metagenomic +proteins in practical timescales.* + + + + +Tips: + +- ESM models are trained with a masked language modeling (MLM) objective. + +The original code can be found [here](https://github.com/facebookresearch/esm) and was +was developed by the Fundamental AI Research team at Meta AI. +This model was contributed to huggingface by [jasonliu](https://huggingface.co/jasonliu) +and [Matt](https://huggingface.co/Rocketknight1). + +## EsmConfig + +[[autodoc]] EsmConfig + - all + +## EsmTokenizer + +[[autodoc]] EsmTokenizer + - build_inputs_with_special_tokens + - get_special_tokens_mask + - create_token_type_ids_from_sequences + - save_vocabulary + + +## EsmModel + +[[autodoc]] EsmModel + - forward + +## EsmForMaskedLM + +[[autodoc]] EsmForMaskedLM + - forward + +## EsmForSequenceClassification + +[[autodoc]] EsmForSequenceClassification + - forward + +## EsmForTokenClassification + +[[autodoc]] EsmForTokenClassification + - forward diff --git a/src/transformers/__init__.py b/src/transformers/__init__.py index 6478bcd7e5..93c3118f69 100755 --- a/src/transformers/__init__.py +++ b/src/transformers/__init__.py @@ -210,6 +210,7 @@ _import_structure = { "ERNIE_PRETRAINED_CONFIG_ARCHIVE_MAP", "ErnieConfig", ], + "models.esm": ["ESM_PRETRAINED_CONFIG_ARCHIVE_MAP", "EsmConfig", "EsmTokenizer"], "models.flaubert": ["FLAUBERT_PRETRAINED_CONFIG_ARCHIVE_MAP", "FlaubertConfig", "FlaubertTokenizer"], "models.flava": [ "FLAVA_PRETRAINED_CONFIG_ARCHIVE_MAP", @@ -1220,6 +1221,16 @@ else: "ErniePreTrainedModel", ] ) + _import_structure["models.esm"].extend( + [ + "ESM_PRETRAINED_MODEL_ARCHIVE_LIST", + "EsmForMaskedLM", + "EsmForSequenceClassification", + "EsmForTokenClassification", + "EsmModel", + "EsmPreTrainedModel", + ] + ) _import_structure["models.flaubert"].extend( [ "FLAUBERT_PRETRAINED_MODEL_ARCHIVE_LIST", @@ -3158,6 +3169,7 @@ if TYPE_CHECKING: from .models.electra import ELECTRA_PRETRAINED_CONFIG_ARCHIVE_MAP, ElectraConfig, ElectraTokenizer from .models.encoder_decoder import EncoderDecoderConfig from .models.ernie import ERNIE_PRETRAINED_CONFIG_ARCHIVE_MAP, ErnieConfig + from .models.esm import ESM_PRETRAINED_CONFIG_ARCHIVE_MAP, EsmConfig, EsmTokenizer from .models.flaubert import FLAUBERT_PRETRAINED_CONFIG_ARCHIVE_MAP, FlaubertConfig, FlaubertTokenizer from .models.flava import ( FLAVA_PRETRAINED_CONFIG_ARCHIVE_MAP, @@ -4010,6 +4022,14 @@ if TYPE_CHECKING: ErnieModel, ErniePreTrainedModel, ) + from .models.esm import ( + ESM_PRETRAINED_MODEL_ARCHIVE_LIST, + EsmForMaskedLM, + EsmForSequenceClassification, + EsmForTokenClassification, + EsmModel, + EsmPreTrainedModel, + ) from .models.flaubert import ( FLAUBERT_PRETRAINED_MODEL_ARCHIVE_LIST, FlaubertForMultipleChoice, diff --git a/src/transformers/models/__init__.py b/src/transformers/models/__init__.py index 261d4c03e2..e30c79480e 100644 --- a/src/transformers/models/__init__.py +++ b/src/transformers/models/__init__.py @@ -60,6 +60,7 @@ from . import ( electra, encoder_decoder, ernie, + esm, flaubert, flava, fnet, diff --git a/src/transformers/models/auto/configuration_auto.py b/src/transformers/models/auto/configuration_auto.py index 781641b74e..bf8c3619fb 100644 --- a/src/transformers/models/auto/configuration_auto.py +++ b/src/transformers/models/auto/configuration_auto.py @@ -64,6 +64,7 @@ CONFIG_MAPPING_NAMES = OrderedDict( ("electra", "ElectraConfig"), ("encoder-decoder", "EncoderDecoderConfig"), ("ernie", "ErnieConfig"), + ("esm", "EsmConfig"), ("flaubert", "FlaubertConfig"), ("flava", "FlavaConfig"), ("fnet", "FNetConfig"), @@ -197,6 +198,7 @@ CONFIG_ARCHIVE_MAP_MAPPING_NAMES = OrderedDict( ("dpt", "DPT_PRETRAINED_CONFIG_ARCHIVE_MAP"), ("electra", "ELECTRA_PRETRAINED_CONFIG_ARCHIVE_MAP"), ("ernie", "ERNIE_PRETRAINED_CONFIG_ARCHIVE_MAP"), + ("esm", "ESM_PRETRAINED_CONFIG_ARCHIVE_MAP"), ("flaubert", "FLAUBERT_PRETRAINED_CONFIG_ARCHIVE_MAP"), ("flava", "FLAVA_PRETRAINED_CONFIG_ARCHIVE_MAP"), ("fnet", "FNET_PRETRAINED_CONFIG_ARCHIVE_MAP"), @@ -331,6 +333,7 @@ MODEL_NAMES_MAPPING = OrderedDict( ("electra", "ELECTRA"), ("encoder-decoder", "Encoder decoder"), ("ernie", "ERNIE"), + ("esm", "ESM"), ("flaubert", "FlauBERT"), ("flava", "FLAVA"), ("fnet", "FNet"), diff --git a/src/transformers/models/auto/modeling_auto.py b/src/transformers/models/auto/modeling_auto.py index d703c5b22a..dba5af0191 100644 --- a/src/transformers/models/auto/modeling_auto.py +++ b/src/transformers/models/auto/modeling_auto.py @@ -63,6 +63,7 @@ MODEL_MAPPING_NAMES = OrderedDict( ("dpt", "DPTModel"), ("electra", "ElectraModel"), ("ernie", "ErnieModel"), + ("esm", "EsmModel"), ("flaubert", "FlaubertModel"), ("flava", "FlavaModel"), ("fnet", "FNetModel"), @@ -231,6 +232,7 @@ MODEL_WITH_LM_HEAD_MAPPING_NAMES = OrderedDict( ("electra", "ElectraForMaskedLM"), ("encoder-decoder", "EncoderDecoderModel"), ("ernie", "ErnieForMaskedLM"), + ("esm", "EsmForMaskedLM"), ("flaubert", "FlaubertWithLMHeadModel"), ("fnet", "FNetForMaskedLM"), ("fsmt", "FSMTForConditionalGeneration"), @@ -519,6 +521,7 @@ MODEL_FOR_SEQUENCE_CLASSIFICATION_MAPPING_NAMES = OrderedDict( ("distilbert", "DistilBertForSequenceClassification"), ("electra", "ElectraForSequenceClassification"), ("ernie", "ErnieForSequenceClassification"), + ("esm", "EsmForSequenceClassification"), ("flaubert", "FlaubertForSequenceClassification"), ("fnet", "FNetForSequenceClassification"), ("funnel", "FunnelForSequenceClassification"), @@ -648,6 +651,7 @@ MODEL_FOR_TOKEN_CLASSIFICATION_MAPPING_NAMES = OrderedDict( ("distilbert", "DistilBertForTokenClassification"), ("electra", "ElectraForTokenClassification"), ("ernie", "ErnieForTokenClassification"), + ("esm", "EsmForTokenClassification"), ("flaubert", "FlaubertForTokenClassification"), ("fnet", "FNetForTokenClassification"), ("funnel", "FunnelForTokenClassification"), diff --git a/src/transformers/models/esm/__init__.py b/src/transformers/models/esm/__init__.py new file mode 100644 index 0000000000..9d1d068772 --- /dev/null +++ b/src/transformers/models/esm/__init__.py @@ -0,0 +1,67 @@ +# flake8: noqa +# There's no way to ignore "F401 '...' imported but unused" warnings in this +# module, but to preserve other warnings. So, don't check this module at all. + +# Copyright 2022 Facebook and The HuggingFace Team. All rights reserved. +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. +from typing import TYPE_CHECKING + +from ...utils import OptionalDependencyNotAvailable, _LazyModule, is_torch_available + + +_import_structure = { + "configuration_esm": ["ESM_PRETRAINED_CONFIG_ARCHIVE_MAP", "EsmConfig"], + "tokenization_esm": ["EsmTokenizer"], +} + +try: + if not is_torch_available(): + raise OptionalDependencyNotAvailable() +except OptionalDependencyNotAvailable: + pass +else: + _import_structure["modeling_esm"] = [ + "ESM_PRETRAINED_MODEL_ARCHIVE_LIST", + "EsmForMaskedLM", + "EsmForSequenceClassification", + "EsmForTokenClassification", + "EsmModel", + "EsmPreTrainedModel", + ] + + +if TYPE_CHECKING: + from .configuration_esm import ESM_PRETRAINED_CONFIG_ARCHIVE_MAP, EsmConfig + from .tokenization_esm import EsmTokenizer + + try: + if not is_torch_available(): + raise OptionalDependencyNotAvailable() + except OptionalDependencyNotAvailable: + pass + else: + from .modeling_esm import ( + ESM_PRETRAINED_MODEL_ARCHIVE_LIST, + EsmForMaskedLM, + EsmForSequenceClassification, + EsmForTokenClassification, + EsmModel, + EsmPreTrainedModel, + ) + + +else: + import sys + + sys.modules[__name__] = _LazyModule(__name__, globals()["__file__"], _import_structure) diff --git a/src/transformers/models/esm/configuration_esm.py b/src/transformers/models/esm/configuration_esm.py new file mode 100644 index 0000000000..6b8f241ffb --- /dev/null +++ b/src/transformers/models/esm/configuration_esm.py @@ -0,0 +1,142 @@ +# coding=utf-8 +# Copyright 2021 Facebook and The HuggingFace Inc. team. All rights reserved. +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. +""" ESM model configuration""" + +from ...configuration_utils import PretrainedConfig +from ...utils import logging + + +logger = logging.get_logger(__name__) + +ESM_PRETRAINED_CONFIG_ARCHIVE_MAP = { + "facebook/esm1b": "https://huggingface.co/facebook/esm1b/resolve/main/config.json", + # See all ESM models at https://huggingface.co/models?filter=esm +} + + +class EsmConfig(PretrainedConfig): + r""" + This is the configuration class to store the configuration of a [`ESMModel`]. It is used to instantiate a ESM model + according to the specified arguments, defining the model architecture. Instantiating a configuration with the + defaults will yield a similar configuration to that of the ESM + [esm-base-uncased](https://huggingface.co/esm-base-uncased) architecture. + + Configuration objects inherit from [`PretrainedConfig`] and can be used to control the model outputs. Read the + documentation from [`PretrainedConfig`] for more information. + + + Args: + vocab_size (`int`, *optional*): + Vocabulary size of the ESM model. Defines the number of different tokens that can be represented by the + `inputs_ids` passed when calling [`ESMModel`]. + mask_token_id (`int`, *optional*): + The index of the mask token in the vocabulary. This must be included in the config because of the + "mask-dropout" scaling trick, which will scale the inputs depending on the number of masked tokens. + pad_token_id (`int`, *optional*): + The index of the padding token in the vocabulary. This must be included in the config because certain parts + of the ESM code use this instead of the attention mask. + hidden_size (`int`, *optional*, defaults to 768): + Dimensionality of the encoder layers and the pooler layer. + num_hidden_layers (`int`, *optional*, defaults to 12): + Number of hidden layers in the Transformer encoder. + num_attention_heads (`int`, *optional*, defaults to 12): + Number of attention heads for each attention layer in the Transformer encoder. + intermediate_size (`int`, *optional*, defaults to 3072): + Dimensionality of the "intermediate" (often named feed-forward) layer in the Transformer encoder. + hidden_act (`str` or `Callable`, *optional*, defaults to `"gelu"`): + The non-linear activation function (function or string) in the encoder and pooler. If string, `"gelu"`, + `"relu"`, `"silu"` and `"gelu_new"` are supported. + hidden_dropout_prob (`float`, *optional*, defaults to 0.1): + The dropout probability for all fully connected layers in the embeddings, encoder, and pooler. + attention_probs_dropout_prob (`float`, *optional*, defaults to 0.1): + The dropout ratio for the attention probabilities. + max_position_embeddings (`int`, *optional*, defaults to 1026): + The maximum sequence length that this model might ever be used with. Typically set this to something large + just in case (e.g., 512 or 1024 or 2048). + initializer_range (`float`, *optional*, defaults to 0.02): + The standard deviation of the truncated_normal_initializer for initializing all weight matrices. + layer_norm_eps (`float`, *optional*, defaults to 1e-12): + The epsilon used by the layer normalization layers. + position_embedding_type (`str`, *optional*, defaults to `"absolute"`): + Type of position embedding. Choose one of `"absolute"`, `"relative_key"`, `"relative_key_query", "rotary"`. + For positional embeddings use `"absolute"`. For more information on `"relative_key"`, please refer to + [Self-Attention with Relative Position Representations (Shaw et al.)](https://arxiv.org/abs/1803.02155). + For more information on `"relative_key_query"`, please refer to *Method 4* in [Improve Transformer Models + with Better Relative Position Embeddings (Huang et al.)](https://arxiv.org/abs/2009.13658). + use_cache (`bool`, *optional*, defaults to `True`): + Whether or not the model should return the last key/values attentions (not used by all models). Only + relevant if `config.is_decoder=True`. + classifier_dropout (`float`, *optional*): + The dropout ratio for the classification head. + emb_layer_norm_before (`bool`, *optional*): + Whether to apply layer normalization after embeddings but before the main stem of the network. + token_dropout (`bool`, defaults to `False`): + When this is enabled, masked tokens are treated as if they had been dropped out by input dropout. + + Examples: + + ```python + >>> from transformers import EsmModel, EsmConfig + + >>> # Initializing a ESM esm-base-uncased style configuration >>> configuration = EsmConfig() + + >>> # Initializing a model from the configuration >>> model = ESMModel(configuration) + + >>> # Accessing the model configuration >>> configuration = model.config + ```""" + model_type = "esm" + + def __init__( + self, + vocab_size=None, + mask_token_id=None, + pad_token_id=None, + hidden_size=768, + num_hidden_layers=12, + num_attention_heads=12, + intermediate_size=3072, + hidden_act="gelu", + hidden_dropout_prob=0.1, + attention_probs_dropout_prob=0.1, + max_position_embeddings=1026, + initializer_range=0.02, + layer_norm_eps=1e-12, + position_embedding_type="absolute", + use_cache=True, + classifier_dropout=None, + emb_layer_norm_before=None, + token_dropout=False, + **kwargs + ): + super().__init__(pad_token_id=pad_token_id, **kwargs) + + self.vocab_size = vocab_size + self.hidden_size = hidden_size + self.num_hidden_layers = num_hidden_layers + self.num_attention_heads = num_attention_heads + self.hidden_act = hidden_act + self.intermediate_size = intermediate_size + self.hidden_dropout_prob = hidden_dropout_prob + self.attention_probs_dropout_prob = attention_probs_dropout_prob + self.max_position_embeddings = max_position_embeddings + self.initializer_range = initializer_range + self.layer_norm_eps = layer_norm_eps + self.position_embedding_type = position_embedding_type + self.use_cache = use_cache + self.classifier_dropout = classifier_dropout + self.emb_layer_norm_before = emb_layer_norm_before + self.token_dropout = token_dropout + self.mask_token_id = mask_token_id + self.pad_token_id = pad_token_id diff --git a/src/transformers/models/esm/convert_esm.py b/src/transformers/models/esm/convert_esm.py new file mode 100644 index 0000000000..20d2586a87 --- /dev/null +++ b/src/transformers/models/esm/convert_esm.py @@ -0,0 +1,264 @@ +# coding=utf-8 +# Copyright 2022 The HuggingFace Inc. team. +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. +"""Convert ESM checkpoint.""" + + +import argparse +import pathlib +from pathlib import Path +from tempfile import TemporaryDirectory + +import torch + +import esm as esm_module +from transformers.models.esm.configuration_esm import EsmConfig +from transformers.models.esm.modeling_esm import ( + EsmForMaskedLM, + EsmForSequenceClassification, + EsmIntermediate, + EsmLayer, + EsmOutput, + EsmSelfAttention, + EsmSelfOutput, +) +from transformers.models.esm.tokenization_esm import EsmTokenizer +from transformers.utils import logging + + +logging.set_verbosity_info() +logger = logging.get_logger(__name__) + +SAMPLE_DATA = [ + ("protein1", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"), + ("protein2", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLA"), + ("protein3", "MKTVRQERLKSIRILERSKEPVSGAQLAEELSSRQVIVQDIAYLRSLGYNVATPRGYVLAGG"), + ("protein4", "MKTVRQERLKSIRILERSKEPVSGAQLAEELSSRQVIVQDIAYLRSLGYNVATPRGYVLA"), +] + +MODEL_MAPPING = { + "esm1b_t33_650M_UR50S": esm_module.pretrained.esm1b_t33_650M_UR50S, + "esm1v_t33_650M_UR90S_1": esm_module.pretrained.esm1v_t33_650M_UR90S_1, + "esm1v_t33_650M_UR90S_2": esm_module.pretrained.esm1v_t33_650M_UR90S_2, + "esm1v_t33_650M_UR90S_3": esm_module.pretrained.esm1v_t33_650M_UR90S_3, + "esm1v_t33_650M_UR90S_4": esm_module.pretrained.esm1v_t33_650M_UR90S_4, + "esm1v_t33_650M_UR90S_5": esm_module.pretrained.esm1v_t33_650M_UR90S_5, + "esm2_t48_15B_UR50D": esm_module.pretrained.esm2_t48_15B_UR50D, + "esm2_t36_3B_UR50D": esm_module.pretrained.esm2_t36_3B_UR50D, + "esm2_t33_650M_UR50D": esm_module.pretrained.esm2_t33_650M_UR50D, + "esm2_t30_150M_UR50D": esm_module.pretrained.esm2_t30_150M_UR50D, + "esm2_t12_35M_UR50D": esm_module.pretrained.esm2_t12_35M_UR50D, + "esm2_t6_8M_UR50D": esm_module.pretrained.esm2_t6_8M_UR50D, +} + + +def convert_esm_checkpoint_to_pytorch( + model: str, pytorch_dump_folder_path: str, classification_head: bool, push_to_repo: str, auth_token: str +): + """ + Copy/paste/tweak esm's weights to our BERT structure. + """ + esm, alphabet = MODEL_MAPPING[model]() + esm.eval() # disable dropout + esm_sent_encoder = esm + if hasattr(esm, "args"): + # Indicates an ESM-1b or ESM-1v model + embed_dim = esm.args.embed_dim + num_layers = esm.args.layers + num_attention_heads = esm.args.attention_heads + intermediate_size = esm.args.ffn_embed_dim + token_dropout = esm.args.token_dropout + emb_layer_norm_before = True if esm.emb_layer_norm_before else False + position_embedding_type = "absolute" + else: + # Indicates an ESM-2 model + embed_dim = esm.embed_dim + num_layers = esm.num_layers + num_attention_heads = esm.attention_heads + intermediate_size = 4 * embed_dim # This is hardcoded in ESM-2 + token_dropout = esm.token_dropout + emb_layer_norm_before = False # This code path does not exist in ESM-2 + position_embedding_type = "rotary" + + config = EsmConfig( + vocab_size=esm_sent_encoder.embed_tokens.num_embeddings, + mask_token_id=alphabet.mask_idx, + hidden_size=embed_dim, + num_hidden_layers=num_layers, + num_attention_heads=num_attention_heads, + intermediate_size=intermediate_size, + max_position_embeddings=1026, + layer_norm_eps=1e-5, # PyTorch default used in fairseq + attention_probs_dropout_prob=0.0, + hidden_dropout_prob=0.0, + pad_token_id=esm.padding_idx, + emb_layer_norm_before=emb_layer_norm_before, + token_dropout=token_dropout, + position_embedding_type=position_embedding_type, + ) + if classification_head: + config.num_labels = esm.classification_heads["mnli"].out_proj.weight.shape[0] + print("Our BERT config:", config) + + model = EsmForSequenceClassification(config) if classification_head else EsmForMaskedLM(config) + model.eval() + + # Now let's copy all the weights. + # Embeddings + model.esm.embeddings.word_embeddings.weight = esm_sent_encoder.embed_tokens.weight + if position_embedding_type == "absolute": + model.esm.embeddings.position_embeddings.weight = esm_sent_encoder.embed_positions.weight + + if config.emb_layer_norm_before: + model.esm.embeddings.layer_norm.weight = esm_sent_encoder.emb_layer_norm_before.weight + model.esm.embeddings.layer_norm.bias = esm_sent_encoder.emb_layer_norm_before.bias + + model.esm.encoder.emb_layer_norm_after.weight = esm_sent_encoder.emb_layer_norm_after.weight + model.esm.encoder.emb_layer_norm_after.bias = esm_sent_encoder.emb_layer_norm_after.bias + + for i in range(config.num_hidden_layers): + # Encoder: start of layer + layer: EsmLayer = model.esm.encoder.layer[i] + # esm_layer: TransformerSentenceEncoderLayer = esm_sent_encoder.layers[i] + esm_layer = esm_sent_encoder.layers[i] + + # self attention + self_attn: EsmSelfAttention = layer.attention.self + assert ( + esm_layer.self_attn.k_proj.weight.data.shape + == esm_layer.self_attn.q_proj.weight.data.shape + == esm_layer.self_attn.v_proj.weight.data.shape + == torch.Size((config.hidden_size, config.hidden_size)) + ) + + self_attn.query.weight.data = esm_layer.self_attn.q_proj.weight + self_attn.query.bias.data = esm_layer.self_attn.q_proj.bias + self_attn.key.weight.data = esm_layer.self_attn.k_proj.weight + self_attn.key.bias.data = esm_layer.self_attn.k_proj.bias + self_attn.value.weight.data = esm_layer.self_attn.v_proj.weight + self_attn.value.bias.data = esm_layer.self_attn.v_proj.bias + + if hasattr(esm_layer.self_attn, "rot_emb"): + # Matt: Although inv_freq is not a trainable weight, it is computed at model init and cached. + # During the training of ESM-2 the model was converted to float16 precision, which also converts + # the inv_freq tensor, and the loss of precision remains even if the model is loaded later as float32. + # If we recompute inv_freq without this loss of precision then we will get subtly different rotary + # embeddings, which are enough to cause significant discrepancies in model outputs. To avoid this, + # we make sure the new model copies the data from the old inv_freq. + self_attn.rotary_embeddings.inv_freq.data = esm_layer.self_attn.rot_emb.inv_freq + + # LayerNorm changes for pre-activation + layer.attention.LayerNorm.weight = esm_layer.self_attn_layer_norm.weight + layer.attention.LayerNorm.bias = esm_layer.self_attn_layer_norm.bias + layer.LayerNorm.weight = esm_layer.final_layer_norm.weight + layer.LayerNorm.bias = esm_layer.final_layer_norm.bias + + # self-attention output + self_output: EsmSelfOutput = layer.attention.output + assert self_output.dense.weight.shape == esm_layer.self_attn.out_proj.weight.shape + self_output.dense.weight = esm_layer.self_attn.out_proj.weight + self_output.dense.bias = esm_layer.self_attn.out_proj.bias + + # intermediate + intermediate: EsmIntermediate = layer.intermediate + assert intermediate.dense.weight.shape == esm_layer.fc1.weight.shape + intermediate.dense.weight = esm_layer.fc1.weight + intermediate.dense.bias = esm_layer.fc1.bias + + # output + bert_output: EsmOutput = layer.output + assert bert_output.dense.weight.shape == esm_layer.fc2.weight.shape + bert_output.dense.weight = esm_layer.fc2.weight + bert_output.dense.bias = esm_layer.fc2.bias + # end of layer + + if classification_head: + model.classifier.dense.weight = esm.esm.classification_heads["mnli"].dense.weight + model.classifier.dense.bias = esm.classification_heads["mnli"].dense.bias + model.classifier.out_proj.weight = esm.classification_heads["mnli"].out_proj.weight + model.classifier.out_proj.bias = esm.classification_heads["mnli"].out_proj.bias + else: + # LM Head + model.lm_head.dense.weight = esm.lm_head.dense.weight + model.lm_head.dense.bias = esm.lm_head.dense.bias + model.lm_head.layer_norm.weight = esm.lm_head.layer_norm.weight + model.lm_head.layer_norm.bias = esm.lm_head.layer_norm.bias + model.lm_head.decoder.weight = esm.lm_head.weight + model.lm_head.decoder.bias = esm.lm_head.bias + + # Let's check that we get the same results. + batch_converter = alphabet.get_batch_converter() + + # Prepare data (first 2 sequences from ESMStructuralSplitDataset superfamily / 4) + + batch_labels, batch_strs, batch_tokens = batch_converter(SAMPLE_DATA) + + # Prepare tokenizer and make sure it matches + with TemporaryDirectory() as tempdir: + vocab = "\n".join(alphabet.all_toks) + vocab_file = Path(tempdir) / "vocab.txt" + vocab_file.write_text(vocab) + hf_tokenizer = EsmTokenizer(vocab_file=str(vocab_file)) + + hf_tokens = hf_tokenizer([row[1] for row in SAMPLE_DATA], return_tensors="pt", padding=True) + success = torch.all(hf_tokens["input_ids"] == batch_tokens) + print("Do both models tokenizers output the same tokens?", "🔥" if success else "💩") + if not success: + raise Exception("Tokenization does not match!") + + with torch.no_grad(): + our_output = model(**hf_tokens, output_hidden_states=True) + our_output = our_output["logits"] + if classification_head: + their_output = esm.model.classification_heads["mnli"](esm.extract_features(batch_tokens)) + else: + their_output = esm(batch_tokens, repr_layers=list(range(999))) + their_output = their_output["logits"] + print(our_output.shape, their_output.shape) + max_absolute_diff = torch.max(torch.abs(our_output - their_output)).item() + print(f"max_absolute_diff = {max_absolute_diff}") # ~ 1e-5 + success = torch.allclose(our_output, their_output, atol=3e-4) + print("Do both models output the same tensors?", "🔥" if success else "💩") + + if not success: + raise Exception("Something went wRoNg") + + pathlib.Path(pytorch_dump_folder_path).mkdir(parents=True, exist_ok=True) + print(f"Saving model to {pytorch_dump_folder_path}") + model.save_pretrained(pytorch_dump_folder_path) + + print(f"Saving tokenizer to {pytorch_dump_folder_path}") + hf_tokenizer.save_pretrained(pytorch_dump_folder_path) + + if push_to_repo: + model.push_to_hub(repo_id=push_to_repo, use_auth_token=auth_token) + hf_tokenizer.push_to_hub(repo_id=push_to_repo, use_auth_token=auth_token) + + +if __name__ == "__main__": + parser = argparse.ArgumentParser() + # Required parameters + parser.add_argument( + "--pytorch_dump_folder_path", type=str, required=True, help="Path to the output PyTorch model." + ) + parser.add_argument( + "--classification_head", action="store_true", help="Whether to convert a final classification head." + ) + parser.add_argument("--model", default=None, type=str, required=True, help="Name of model to convert.") + parser.add_argument("--push_to_repo", type=str, help="Repo to upload to (including username!).") + parser.add_argument("--auth_token", type=str, help="HuggingFace auth token.") + args = parser.parse_args() + convert_esm_checkpoint_to_pytorch( + args.model, args.pytorch_dump_folder_path, args.classification_head, args.push_to_repo, args.auth_token + ) diff --git a/src/transformers/models/esm/modeling_esm.py b/src/transformers/models/esm/modeling_esm.py new file mode 100755 index 0000000000..337f7e3716 --- /dev/null +++ b/src/transformers/models/esm/modeling_esm.py @@ -0,0 +1,1241 @@ +# coding=utf-8 +# Copyright 2022 Facebook and The HuggingFace Inc. team. All rights reserved. +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. +""" PyTorch ESM model.""" + +from typing import List, Optional, Tuple, Union + +import torch +import torch.utils.checkpoint +from torch import nn +from torch.nn import BCEWithLogitsLoss, CrossEntropyLoss, MSELoss + +from ...activations import ACT2FN, gelu +from ...file_utils import add_code_sample_docstrings, add_start_docstrings, add_start_docstrings_to_model_forward +from ...modeling_outputs import ( + BaseModelOutputWithPastAndCrossAttentions, + BaseModelOutputWithPoolingAndCrossAttentions, + MaskedLMOutput, + SequenceClassifierOutput, + TokenClassifierOutput, +) +from ...modeling_utils import ( + PreTrainedModel, + apply_chunking_to_forward, + find_pruneable_heads_and_indices, + prune_linear_layer, +) +from ...utils import logging +from .configuration_esm import EsmConfig + + +logger = logging.get_logger(__name__) + +_CHECKPOINT_FOR_DOC = "facebook/esm-1b" +_CONFIG_FOR_DOC = "EsmConfig" +_TOKENIZER_FOR_DOC = "EsmTokenizer" + +ESM_PRETRAINED_MODEL_ARCHIVE_LIST = [ + "facebook/esm-1b", + # See all ESM models at https://huggingface.co/models?filter=esm +] + + +def rotate_half(x): + x1, x2 = x.chunk(2, dim=-1) + return torch.cat((-x2, x1), dim=-1) + + +def apply_rotary_pos_emb(x, cos, sin): + cos = cos[:, :, : x.shape[-2], :] + sin = sin[:, :, : x.shape[-2], :] + + return (x * cos) + (rotate_half(x) * sin) + + +class RotaryEmbedding(torch.nn.Module): + """ + Rotary position embeddings based on those in + [RoFormer](https://huggingface.co/docs/transformers/model_doc/roformer). Query and keys are transformed by rotation + matrices which depend on their relative positions. + """ + + def __init__(self, dim: int): + super().__init__() + # Generate and save the inverse frequency buffer (non trainable) + inv_freq = 1.0 / (10000 ** (torch.arange(0, dim, 2).float() / dim)) + inv_freq = inv_freq + self.register_buffer("inv_freq", inv_freq) + + self._seq_len_cached = None + self._cos_cached = None + self._sin_cached = None + + def _update_cos_sin_tables(self, x, seq_dimension=2): + seq_len = x.shape[seq_dimension] + + # Reset the tables if the sequence length has changed, + # or if we're on a new device (possibly due to tracing for instance) + if seq_len != self._seq_len_cached or self._cos_cached.device != x.device: + self._seq_len_cached = seq_len + t = torch.arange(x.shape[seq_dimension], device=x.device).type_as(self.inv_freq) + freqs = torch.outer(t, self.inv_freq) + emb = torch.cat((freqs, freqs), dim=-1).to(x.device) + + self._cos_cached = emb.cos()[None, None, :, :] + self._sin_cached = emb.sin()[None, None, :, :] + + return self._cos_cached, self._sin_cached + + def forward(self, q: torch.Tensor, k: torch.Tensor) -> Tuple[torch.Tensor, torch.Tensor]: + self._cos_cached, self._sin_cached = self._update_cos_sin_tables(k, seq_dimension=-2) + + return ( + apply_rotary_pos_emb(q, self._cos_cached, self._sin_cached), + apply_rotary_pos_emb(k, self._cos_cached, self._sin_cached), + ) + + +class EsmEmbeddings(nn.Module): + """ + Same as BertEmbeddings with a tiny tweak for positional embeddings indexing. + """ + + def __init__(self, config): + super().__init__() + self.word_embeddings = nn.Embedding(config.vocab_size, config.hidden_size, padding_idx=config.pad_token_id) + self.position_embeddings = nn.Embedding(config.max_position_embeddings, config.hidden_size) + + if config.emb_layer_norm_before: + self.layer_norm = nn.LayerNorm(config.hidden_size, eps=config.layer_norm_eps) + else: + self.layer_norm = None + self.dropout = nn.Dropout(config.hidden_dropout_prob) + # position_ids (1, len position emb) is contiguous in memory and exported when serialized + self.position_embedding_type = getattr(config, "position_embedding_type", "absolute") + self.register_buffer("position_ids", torch.arange(config.max_position_embeddings).expand((1, -1))) + + self.padding_idx = config.pad_token_id + self.position_embeddings = nn.Embedding( + config.max_position_embeddings, config.hidden_size, padding_idx=self.padding_idx + ) + self.token_dropout = config.token_dropout + self.mask_token_id = config.mask_token_id + + def forward( + self, input_ids=None, attention_mask=None, position_ids=None, inputs_embeds=None, past_key_values_length=0 + ): + if position_ids is None: + if input_ids is not None: + # Create the position ids from the input token ids. Any padded tokens remain padded. + position_ids = create_position_ids_from_input_ids(input_ids, self.padding_idx, past_key_values_length) + else: + position_ids = self.create_position_ids_from_inputs_embeds(inputs_embeds) + + if inputs_embeds is None: + inputs_embeds = self.word_embeddings(input_ids) + + # Note that if we want to support ESM-1 (not 1b!) in future then we need to support an + # embedding_scale factor here. + embeddings = inputs_embeds + + # Matt: ESM has the option to handle masking in MLM in a slightly unusual way. If the token_dropout + # flag is False then it is handled in the same was as BERT/RoBERTa. If it is set to True, however, + # masked tokens are treated as if they were selected for input dropout and zeroed out. + # This "mask-dropout" is compensated for when masked tokens are not present, by scaling embeddings by + # a factor of (fraction of unmasked tokens during training) / (fraction of unmasked tokens in sample). + # This is analogous to the way that dropout layers scale down outputs during evaluation when not + # actually dropping out values (or, equivalently, scale up their un-dropped outputs in training). + if self.token_dropout: + embeddings.masked_fill_((input_ids == self.mask_token_id).unsqueeze(-1), 0.0) + mask_ratio_train = 0.15 * 0.8 # Hardcoded as the ratio used in all ESM model training runs + src_lengths = attention_mask.sum(-1) + mask_ratio_observed = (input_ids == self.mask_token_id).sum(-1).float() / src_lengths + embeddings = embeddings * (1 - mask_ratio_train) / (1 - mask_ratio_observed)[:, None, None] + + if self.position_embedding_type == "absolute": + position_embeddings = self.position_embeddings(position_ids) + embeddings += position_embeddings + + if self.layer_norm is not None: + embeddings = self.layer_norm(embeddings) + if attention_mask is not None: + embeddings = embeddings * attention_mask.unsqueeze(-1) + # Matt: I think this line was copied incorrectly from BERT, disabling it for now. + # embeddings = self.dropout(embeddings) + return embeddings + + def create_position_ids_from_inputs_embeds(self, inputs_embeds): + """ + We are provided embeddings directly. We cannot infer which are padded so just generate sequential position ids. + + Args: + inputs_embeds: torch.Tensor + + Returns: torch.Tensor + """ + input_shape = inputs_embeds.size()[:-1] + sequence_length = input_shape[1] + + position_ids = torch.arange( + self.padding_idx + 1, sequence_length + self.padding_idx + 1, dtype=torch.long, device=inputs_embeds.device + ) + return position_ids.unsqueeze(0).expand(input_shape) + + +class EsmSelfAttention(nn.Module): + def __init__(self, config, position_embedding_type=None): + super().__init__() + if config.hidden_size % config.num_attention_heads != 0 and not hasattr(config, "embedding_size"): + raise ValueError( + f"The hidden size ({config.hidden_size}) is not a multiple of the number of attention " + f"heads ({config.num_attention_heads})" + ) + + self.num_attention_heads = config.num_attention_heads + self.attention_head_size = int(config.hidden_size / config.num_attention_heads) + self.all_head_size = self.num_attention_heads * self.attention_head_size + + self.query = nn.Linear(config.hidden_size, self.all_head_size) + self.key = nn.Linear(config.hidden_size, self.all_head_size) + self.value = nn.Linear(config.hidden_size, self.all_head_size) + + self.dropout = nn.Dropout(config.attention_probs_dropout_prob) + self.position_embedding_type = position_embedding_type or getattr( + config, "position_embedding_type", "absolute" + ) + self.rotary_embeddings = None + if self.position_embedding_type == "relative_key" or self.position_embedding_type == "relative_key_query": + self.max_position_embeddings = config.max_position_embeddings + self.distance_embedding = nn.Embedding(2 * config.max_position_embeddings - 1, self.attention_head_size) + elif self.position_embedding_type == "rotary": + self.rotary_embeddings = RotaryEmbedding(dim=self.attention_head_size) + + self.is_decoder = config.is_decoder + + def transpose_for_scores(self, x: torch.Tensor) -> torch.Tensor: + new_x_shape = x.size()[:-1] + (self.num_attention_heads, self.attention_head_size) + x = x.view(new_x_shape) + return x.permute(0, 2, 1, 3) + + def forward( + self, + hidden_states: torch.Tensor, + attention_mask: Optional[torch.FloatTensor] = None, + head_mask: Optional[torch.FloatTensor] = None, + encoder_hidden_states: Optional[torch.FloatTensor] = None, + encoder_attention_mask: Optional[torch.FloatTensor] = None, + past_key_value: Optional[Tuple[Tuple[torch.FloatTensor]]] = None, + output_attentions: Optional[bool] = False, + ) -> Tuple[torch.Tensor]: + + mixed_query_layer = self.query(hidden_states) + + # If this is instantiated as a cross-attention module, the keys + # and values come from an encoder; the attention mask needs to be + # such that the encoder's padding tokens are not attended to. + is_cross_attention = encoder_hidden_states is not None + + if is_cross_attention and past_key_value is not None: + # reuse k,v, cross_attentions + key_layer = past_key_value[0] + value_layer = past_key_value[1] + attention_mask = encoder_attention_mask + elif is_cross_attention: + key_layer = self.transpose_for_scores(self.key(encoder_hidden_states)) + value_layer = self.transpose_for_scores(self.value(encoder_hidden_states)) + attention_mask = encoder_attention_mask + elif past_key_value is not None: + key_layer = self.transpose_for_scores(self.key(hidden_states)) + value_layer = self.transpose_for_scores(self.value(hidden_states)) + key_layer = torch.cat([past_key_value[0], key_layer], dim=2) + value_layer = torch.cat([past_key_value[1], value_layer], dim=2) + else: + key_layer = self.transpose_for_scores(self.key(hidden_states)) + value_layer = self.transpose_for_scores(self.value(hidden_states)) + + query_layer = self.transpose_for_scores(mixed_query_layer) + + # Matt: Our BERT model (which this code was derived from) scales attention logits down by sqrt(head_dim). + # ESM scales the query down by the same factor instead. Modulo numerical stability these are equivalent, + # but not when rotary embeddings get involved. Therefore, we scale the query here to match the original + # ESM code and fix rotary embeddings. + query_layer = query_layer * self.attention_head_size**-0.5 + + if self.is_decoder: + # if cross_attention save Tuple(torch.Tensor, torch.Tensor) of all cross attention key/value_states. + # Further calls to cross_attention layer can then reuse all cross-attention + # key/value_states (first "if" case) + # if uni-directional self-attention (decoder) save Tuple(torch.Tensor, torch.Tensor) of + # all previous decoder key/value_states. Further calls to uni-directional self-attention + # can concat previous decoder key/value_states to current projected key/value_states (third "elif" case) + # if encoder bi-directional self-attention `past_key_value` is always `None` + past_key_value = (key_layer, value_layer) + + if self.position_embedding_type == "rotary": + query_layer, key_layer = self.rotary_embeddings(query_layer, key_layer) + + # Take the dot product between "query" and "key" to get the raw attention scores. + attention_scores = torch.matmul(query_layer, key_layer.transpose(-1, -2)) + + if self.position_embedding_type == "relative_key" or self.position_embedding_type == "relative_key_query": + seq_length = hidden_states.size()[1] + position_ids_l = torch.arange(seq_length, dtype=torch.long, device=hidden_states.device).view(-1, 1) + position_ids_r = torch.arange(seq_length, dtype=torch.long, device=hidden_states.device).view(1, -1) + distance = position_ids_l - position_ids_r + positional_embedding = self.distance_embedding(distance + self.max_position_embeddings - 1) + positional_embedding = positional_embedding.to(dtype=query_layer.dtype) # fp16 compatibility + + if self.position_embedding_type == "relative_key": + relative_position_scores = torch.einsum("bhld,lrd->bhlr", query_layer, positional_embedding) + attention_scores = attention_scores + relative_position_scores + elif self.position_embedding_type == "relative_key_query": + relative_position_scores_query = torch.einsum("bhld,lrd->bhlr", query_layer, positional_embedding) + relative_position_scores_key = torch.einsum("bhrd,lrd->bhlr", key_layer, positional_embedding) + attention_scores = attention_scores + relative_position_scores_query + relative_position_scores_key + + if attention_mask is not None: + # Apply the attention mask is (precomputed for all layers in EsmModel forward() function) + attention_scores = attention_scores + attention_mask + + # Normalize the attention scores to probabilities. + attention_probs = nn.functional.softmax(attention_scores, dim=-1) + + # This is actually dropping out entire tokens to attend to, which might + # seem a bit unusual, but is taken from the original Transformer paper. + attention_probs = self.dropout(attention_probs) + + # Mask heads if we want to + if head_mask is not None: + attention_probs = attention_probs * head_mask + + context_layer = torch.matmul(attention_probs, value_layer) + + context_layer = context_layer.permute(0, 2, 1, 3).contiguous() + new_context_layer_shape = context_layer.size()[:-2] + (self.all_head_size,) + context_layer = context_layer.view(new_context_layer_shape) + + outputs = (context_layer, attention_probs) if output_attentions else (context_layer,) + + if self.is_decoder: + outputs = outputs + (past_key_value,) + return outputs + + +class EsmSelfOutput(nn.Module): + def __init__(self, config): + super().__init__() + self.dense = nn.Linear(config.hidden_size, config.hidden_size) + self.dropout = nn.Dropout(config.hidden_dropout_prob) + + def forward(self, hidden_states, input_tensor): + hidden_states = self.dense(hidden_states) + hidden_states = self.dropout(hidden_states) + hidden_states += input_tensor + return hidden_states + + +class EsmAttention(nn.Module): + def __init__(self, config): + super().__init__() + self.self = EsmSelfAttention(config) + self.output = EsmSelfOutput(config) + self.pruned_heads = set() + self.LayerNorm = nn.LayerNorm(config.hidden_size, eps=config.layer_norm_eps) + + def prune_heads(self, heads): + if len(heads) == 0: + return + heads, index = find_pruneable_heads_and_indices( + heads, self.self.num_attention_heads, self.self.attention_head_size, self.pruned_heads + ) + + # Prune linear layers + self.self.query = prune_linear_layer(self.self.query, index) + self.self.key = prune_linear_layer(self.self.key, index) + self.self.value = prune_linear_layer(self.self.value, index) + self.output.dense = prune_linear_layer(self.output.dense, index, dim=1) + + # Update hyper params and store pruned heads + self.self.num_attention_heads = self.self.num_attention_heads - len(heads) + self.self.all_head_size = self.self.attention_head_size * self.self.num_attention_heads + self.pruned_heads = self.pruned_heads.union(heads) + + def forward( + self, + hidden_states, + attention_mask=None, + head_mask=None, + encoder_hidden_states=None, + encoder_attention_mask=None, + past_key_value=None, + output_attentions=False, + ): + hidden_states_ln = self.LayerNorm(hidden_states) + self_outputs = self.self( + hidden_states_ln, + attention_mask, + head_mask, + encoder_hidden_states, + encoder_attention_mask, + past_key_value, + output_attentions, + ) + attention_output = self.output(self_outputs[0], hidden_states) + outputs = (attention_output,) + self_outputs[1:] # add attentions if we output them + return outputs + + +# Copied from transformers.models.bert.modeling_bert.BertIntermediate +class EsmIntermediate(nn.Module): + def __init__(self, config): + super().__init__() + self.dense = nn.Linear(config.hidden_size, config.intermediate_size) + if isinstance(config.hidden_act, str): + self.intermediate_act_fn = ACT2FN[config.hidden_act] + else: + self.intermediate_act_fn = config.hidden_act + + def forward(self, hidden_states: torch.Tensor) -> torch.Tensor: + hidden_states = self.dense(hidden_states) + hidden_states = self.intermediate_act_fn(hidden_states) + return hidden_states + + +class EsmOutput(nn.Module): + def __init__(self, config): + super().__init__() + self.dense = nn.Linear(config.intermediate_size, config.hidden_size) + self.dropout = nn.Dropout(config.hidden_dropout_prob) + + def forward(self, hidden_states, input_tensor): + hidden_states = self.dense(hidden_states) + hidden_states = self.dropout(hidden_states) + hidden_states += input_tensor + return hidden_states + + +class EsmLayer(nn.Module): + def __init__(self, config): + super().__init__() + self.chunk_size_feed_forward = config.chunk_size_feed_forward + self.seq_len_dim = 1 + self.attention = EsmAttention(config) + self.is_decoder = config.is_decoder + self.add_cross_attention = config.add_cross_attention + if self.add_cross_attention: + if not self.is_decoder: + raise RuntimeError(f"{self} should be used as a decoder model if cross attention is added") + self.crossattention = EsmAttention(config) + self.intermediate = EsmIntermediate(config) + self.output = EsmOutput(config) + self.LayerNorm = nn.LayerNorm(config.hidden_size, eps=config.layer_norm_eps) + + def forward( + self, + hidden_states, + attention_mask=None, + head_mask=None, + encoder_hidden_states=None, + encoder_attention_mask=None, + past_key_value=None, + output_attentions=False, + ): + # decoder uni-directional self-attention cached key/values tuple is at positions 1,2 + self_attn_past_key_value = past_key_value[:2] if past_key_value is not None else None + self_attention_outputs = self.attention( + hidden_states, + attention_mask, + head_mask, + output_attentions=output_attentions, + past_key_value=self_attn_past_key_value, + ) + attention_output = self_attention_outputs[0] + + # if decoder, the last output is tuple of self-attn cache + if self.is_decoder: + outputs = self_attention_outputs[1:-1] + present_key_value = self_attention_outputs[-1] + else: + outputs = self_attention_outputs[1:] # add self attentions if we output attention weights + + cross_attn_present_key_value = None + if self.is_decoder and encoder_hidden_states is not None: + if not hasattr(self, "crossattention"): + raise AttributeError( + f"If `encoder_hidden_states` are passed, {self} has to be instantiated" + " with cross-attention layers by setting `config.add_cross_attention=True`" + ) + + # cross_attn cached key/values tuple is at positions 3,4 of past_key_value tuple + cross_attn_past_key_value = past_key_value[-2:] if past_key_value is not None else None + cross_attention_outputs = self.crossattention( + attention_output, + attention_mask, + head_mask, + encoder_hidden_states, + encoder_attention_mask, + cross_attn_past_key_value, + output_attentions, + ) + attention_output = cross_attention_outputs[0] + outputs = outputs + cross_attention_outputs[1:-1] # add cross attentions if we output attention weights + + # add cross-attn cache to positions 3,4 of present_key_value tuple + cross_attn_present_key_value = cross_attention_outputs[-1] + present_key_value = present_key_value + cross_attn_present_key_value + + layer_output = apply_chunking_to_forward( + self.feed_forward_chunk, self.chunk_size_feed_forward, self.seq_len_dim, attention_output + ) + outputs = (layer_output,) + outputs + + # if decoder, return the attn key/values as the last output + if self.is_decoder: + outputs = outputs + (present_key_value,) + + return outputs + + def feed_forward_chunk(self, attention_output): + attention_output_ln = self.LayerNorm(attention_output) + intermediate_output = self.intermediate(attention_output_ln) + layer_output = self.output(intermediate_output, attention_output) + return layer_output + + +class EsmEncoder(nn.Module): + def __init__(self, config): + super().__init__() + self.config = config + self.layer = nn.ModuleList([EsmLayer(config) for _ in range(config.num_hidden_layers)]) + self.emb_layer_norm_after = nn.LayerNorm(config.hidden_size, eps=config.layer_norm_eps) + self.gradient_checkpointing = False + + def forward( + self, + hidden_states, + attention_mask=None, + head_mask=None, + encoder_hidden_states=None, + encoder_attention_mask=None, + past_key_values=None, + use_cache=None, + output_attentions=False, + output_hidden_states=False, + return_dict=True, + ): + all_hidden_states = () if output_hidden_states else None + all_self_attentions = () if output_attentions else None + all_cross_attentions = () if output_attentions and self.config.add_cross_attention else None + + next_decoder_cache = () if use_cache else None + for i, layer_module in enumerate(self.layer): + if output_hidden_states: + all_hidden_states = all_hidden_states + (hidden_states,) + + layer_head_mask = head_mask[i] if head_mask is not None else None + past_key_value = past_key_values[i] if past_key_values is not None else None + + if self.gradient_checkpointing and self.training: + + if use_cache: + logger.warning( + "`use_cache=True` is incompatible with `config.gradient_checkpointing=True`. Setting " + "`use_cache=False`..." + ) + use_cache = False + + def create_custom_forward(module): + def custom_forward(*inputs): + return module(*inputs, past_key_value, output_attentions) + + return custom_forward + + layer_outputs = torch.utils.checkpoint.checkpoint( + create_custom_forward(layer_module), + hidden_states, + attention_mask, + layer_head_mask, + encoder_hidden_states, + encoder_attention_mask, + ) + else: + layer_outputs = layer_module( + hidden_states, + attention_mask, + layer_head_mask, + encoder_hidden_states, + encoder_attention_mask, + past_key_value, + output_attentions, + ) + + hidden_states = layer_outputs[0] + if use_cache: + next_decoder_cache += (layer_outputs[-1],) + if output_attentions: + all_self_attentions = all_self_attentions + (layer_outputs[1],) + if self.config.add_cross_attention: + all_cross_attentions = all_cross_attentions + (layer_outputs[2],) + + if self.emb_layer_norm_after: + hidden_states = self.emb_layer_norm_after(hidden_states) + + if output_hidden_states: + all_hidden_states = all_hidden_states + (hidden_states,) + + if not return_dict: + return tuple( + v + for v in [ + hidden_states, + next_decoder_cache, + all_hidden_states, + all_self_attentions, + all_cross_attentions, + ] + if v is not None + ) + return BaseModelOutputWithPastAndCrossAttentions( + last_hidden_state=hidden_states, + past_key_values=next_decoder_cache, + hidden_states=all_hidden_states, + attentions=all_self_attentions, + cross_attentions=all_cross_attentions, + ) + + +# Copied from transformers.models.bert.modeling_bert.BertPooler +class EsmPooler(nn.Module): + def __init__(self, config): + super().__init__() + self.dense = nn.Linear(config.hidden_size, config.hidden_size) + self.activation = nn.Tanh() + + def forward(self, hidden_states: torch.Tensor) -> torch.Tensor: + # We "pool" the model by simply taking the hidden state corresponding + # to the first token. + first_token_tensor = hidden_states[:, 0] + pooled_output = self.dense(first_token_tensor) + pooled_output = self.activation(pooled_output) + return pooled_output + + +class EsmPreTrainedModel(PreTrainedModel): + """ + An abstract class to handle weights initialization and a simple interface for downloading and loading pretrained + models. + """ + + config_class = EsmConfig + base_model_prefix = "esm" + + # Copied from transformers.models.bert.modeling_bert.BertPreTrainedModel._init_weights + def _init_weights(self, module): + """Initialize the weights""" + if isinstance(module, nn.Linear): + # Slightly different from the TF version which uses truncated_normal for initialization + # cf https://github.com/pytorch/pytorch/pull/5617 + module.weight.data.normal_(mean=0.0, std=self.config.initializer_range) + if module.bias is not None: + module.bias.data.zero_() + elif isinstance(module, nn.Embedding): + module.weight.data.normal_(mean=0.0, std=self.config.initializer_range) + if module.padding_idx is not None: + module.weight.data[module.padding_idx].zero_() + elif isinstance(module, nn.LayerNorm): + module.bias.data.zero_() + module.weight.data.fill_(1.0) + + def update_keys_to_ignore(self, config, del_keys_to_ignore): + """Remove some keys from ignore list""" + if not config.tie_word_embeddings: + # must make a new list, or the class variable gets modified! + self._keys_to_ignore_on_save = [k for k in self._keys_to_ignore_on_save if k not in del_keys_to_ignore] + self._keys_to_ignore_on_load_missing = [ + k for k in self._keys_to_ignore_on_load_missing if k not in del_keys_to_ignore + ] + + +ESM_START_DOCSTRING = r""" + + This model inherits from [`PreTrainedModel`]. Check the superclass documentation for the generic methods the + library implements for all its model (such as downloading or saving, resizing the input embeddings, pruning heads + etc.) + + This model is also a PyTorch [torch.nn.Module](https://pytorch.org/docs/stable/nn.html#torch.nn.Module) subclass. + Use it as a regular PyTorch Module and refer to the PyTorch documentation for all matter related to general usage + and behavior. + + Parameters: + config ([`EsmConfig`]): Model configuration class with all the parameters of the + model. Initializing with a config file does not load the weights associated with the model, only the + configuration. Check out the [`~PreTrainedModel.from_pretrained`] method to load the model weights. +""" + +ESM_INPUTS_DOCSTRING = r""" + Args: + input_ids (`torch.LongTensor` of shape `({0})`): + Indices of input sequence tokens in the vocabulary. + + Indices can be obtained using [`EsmTokenizer`]. See [`PreTrainedTokenizer.encode`] and + [`PreTrainedTokenizer.__call__`] for details. + + [What are input IDs?](../glossary#input-ids) + attention_mask (`torch.FloatTensor` of shape `({0})`, *optional*): + Mask to avoid performing attention on padding token indices. Mask values selected in `[0, 1]`: + + - 1 for tokens that are **not masked**, + - 0 for tokens that are **masked**. + + [What are attention masks?](../glossary#attention-mask) + position_ids (`torch.LongTensor` of shape `({0})`, *optional*): + Indices of positions of each input sequence tokens in the position embeddings. Selected in the range `[0, + config.max_position_embeddings - 1]`. + + [What are position IDs?](../glossary#position-ids) + head_mask (`torch.FloatTensor` of shape `(num_heads,)` or `(num_layers, num_heads)`, *optional*): + Mask to nullify selected heads of the self-attention modules. Mask values selected in `[0, 1]`: + + - 1 indicates the head is **not masked**, + - 0 indicates the head is **masked**. + + inputs_embeds (`torch.FloatTensor` of shape `({0}, hidden_size)`, *optional*): + Optionally, instead of passing `input_ids` you can choose to directly pass an embedded representation. This + is useful if you want more control over how to convert `input_ids` indices into associated vectors than the + model's internal embedding lookup matrix. + output_attentions (`bool`, *optional*): + Whether or not to return the attentions tensors of all attention layers. See `attentions` under returned + tensors for more detail. + output_hidden_states (`bool`, *optional*): + Whether or not to return the hidden states of all layers. See `hidden_states` under returned tensors for + more detail. + return_dict (`bool`, *optional*): + Whether or not to return a [`~file_utils.ModelOutput`] instead of a plain tuple. +""" + + +@add_start_docstrings( + "The bare ESM Model transformer outputting raw hidden-states without any specific head on top.", + ESM_START_DOCSTRING, +) +class EsmModel(EsmPreTrainedModel): + """ + + The model can behave as an encoder (with only self-attention) as well as a decoder, in which case a layer of + cross-attention is added between the self-attention layers, following the architecture described in [Attention is + all you need](https://arxiv.org/abs/1706.03762) by Ashish Vaswani, Noam Shazeer, Niki Parmar, Jakob Uszkoreit, + Llion Jones, Aidan N. Gomez, Lukasz Kaiser and Illia Polosukhin. + + To behave as an decoder the model needs to be initialized with the `is_decoder` argument of the configuration set + to `True`. To be used in a Seq2Seq model, the model needs to initialized with both `is_decoder` argument and + `add_cross_attention` set to `True`; an `encoder_hidden_states` is then expected as an input to the forward pass. + """ + + _keys_to_ignore_on_load_missing = [r"position_ids"] + supports_gradient_checkpointing = False + + # Copied from transformers.models.bert.modeling_bert.BertModel.__init__ with Bert->Esm + def __init__(self, config, add_pooling_layer=True): + super().__init__(config) + self.config = config + + self.embeddings = EsmEmbeddings(config) + self.encoder = EsmEncoder(config) + + self.pooler = EsmPooler(config) if add_pooling_layer else None + + # Initialize weights and apply final processing + self.post_init() + + def _set_gradient_checkpointing(self, module, value=False): + if isinstance(module, EsmEncoder): + module.gradient_checkpointing = value + + def get_input_embeddings(self): + return self.embeddings.word_embeddings + + def set_input_embeddings(self, value): + self.embeddings.word_embeddings = value + + def _prune_heads(self, heads_to_prune): + """ + Prunes heads of the model. heads_to_prune: dict of {layer_num: list of heads to prune in this layer} See base + class PreTrainedModel + """ + for layer, heads in heads_to_prune.items(): + self.encoder.layer[layer].attention.prune_heads(heads) + + @add_start_docstrings_to_model_forward(ESM_INPUTS_DOCSTRING.format("(batch_size, sequence_length)")) + @add_code_sample_docstrings( + processor_class=_TOKENIZER_FOR_DOC, + checkpoint=_CHECKPOINT_FOR_DOC, + output_type=BaseModelOutputWithPoolingAndCrossAttentions, + config_class=_CONFIG_FOR_DOC, + ) + def forward( + self, + input_ids: Optional[torch.Tensor] = None, + attention_mask: Optional[torch.Tensor] = None, + position_ids: Optional[torch.Tensor] = None, + head_mask: Optional[torch.Tensor] = None, + inputs_embeds: Optional[torch.Tensor] = None, + encoder_hidden_states: Optional[torch.Tensor] = None, + encoder_attention_mask: Optional[torch.Tensor] = None, + past_key_values: Optional[List[torch.FloatTensor]] = None, + use_cache: Optional[bool] = None, + output_attentions: Optional[bool] = None, + output_hidden_states: Optional[bool] = None, + return_dict: Optional[bool] = None, + ) -> Union[Tuple[torch.Tensor], BaseModelOutputWithPoolingAndCrossAttentions]: + r""" + encoder_hidden_states (`torch.FloatTensor` of shape `(batch_size, sequence_length, hidden_size)`, *optional*): + Sequence of hidden-states at the output of the last layer of the encoder. Used in the cross-attention if + the model is configured as a decoder. + encoder_attention_mask (`torch.FloatTensor` of shape `(batch_size, sequence_length)`, *optional*): + Mask to avoid performing attention on the padding token indices of the encoder input. This mask is used in + the cross-attention if the model is configured as a decoder. Mask values selected in `[0, 1]`: + + - 1 for tokens that are **not masked**, + - 0 for tokens that are **masked**. + past_key_values (`tuple(tuple(torch.FloatTensor))` of length `config.n_layers` with each tuple having 4 tensors of shape `(batch_size, num_heads, sequence_length - 1, embed_size_per_head)`): + Contains precomputed key and value hidden states of the attention blocks. Can be used to speed up decoding. + + If `past_key_values` are used, the user can optionally input only the last `decoder_input_ids` (those that + don't have their past key value states given to this model) of shape `(batch_size, 1)` instead of all + `decoder_input_ids` of shape `(batch_size, sequence_length)`. + use_cache (`bool`, *optional*): + If set to `True`, `past_key_values` key value states are returned and can be used to speed up decoding (see + `past_key_values`). + """ + output_attentions = output_attentions if output_attentions is not None else self.config.output_attentions + output_hidden_states = ( + output_hidden_states if output_hidden_states is not None else self.config.output_hidden_states + ) + return_dict = return_dict if return_dict is not None else self.config.use_return_dict + + if self.config.is_decoder: + use_cache = use_cache if use_cache is not None else self.config.use_cache + else: + use_cache = False + + if input_ids is not None and inputs_embeds is not None: + raise ValueError("You cannot specify both input_ids and inputs_embeds at the same time") + elif input_ids is not None: + input_shape = input_ids.size() + elif inputs_embeds is not None: + input_shape = inputs_embeds.size()[:-1] + else: + raise ValueError("You have to specify either input_ids or inputs_embeds") + + batch_size, seq_length = input_shape + device = input_ids.device if input_ids is not None else inputs_embeds.device + + # past_key_values_length + past_key_values_length = past_key_values[0][0].shape[2] if past_key_values is not None else 0 + + if attention_mask is None: + attention_mask = torch.ones(((batch_size, seq_length + past_key_values_length)), device=device) + + # We can provide a self-attention mask of dimensions [batch_size, from_seq_length, to_seq_length] + # ourselves in which case we just need to make it broadcastable to all heads. + extended_attention_mask: torch.Tensor = self.get_extended_attention_mask(attention_mask, input_shape) + + # If a 2D or 3D attention mask is provided for the cross-attention + # we need to make broadcastable to [batch_size, num_heads, seq_length, seq_length] + if self.config.is_decoder and encoder_hidden_states is not None: + encoder_batch_size, encoder_sequence_length, _ = encoder_hidden_states.size() + encoder_hidden_shape = (encoder_batch_size, encoder_sequence_length) + if encoder_attention_mask is None: + encoder_attention_mask = torch.ones(encoder_hidden_shape, device=device) + encoder_extended_attention_mask = self.invert_attention_mask(encoder_attention_mask) + else: + encoder_extended_attention_mask = None + + # Prepare head mask if needed + # 1.0 in head_mask indicate we keep the head + # attention_probs has shape bsz x n_heads x N x N + # input head_mask has shape [num_heads] or [num_hidden_layers x num_heads] + # and head_mask is converted to shape [num_hidden_layers x batch x num_heads x seq_length x seq_length] + head_mask = self.get_head_mask(head_mask, self.config.num_hidden_layers) + + embedding_output = self.embeddings( + input_ids=input_ids, + position_ids=position_ids, + attention_mask=attention_mask, + inputs_embeds=inputs_embeds, + past_key_values_length=past_key_values_length, + ) + encoder_outputs = self.encoder( + embedding_output, + attention_mask=extended_attention_mask, + head_mask=head_mask, + encoder_hidden_states=encoder_hidden_states, + encoder_attention_mask=encoder_extended_attention_mask, + past_key_values=past_key_values, + use_cache=use_cache, + output_attentions=output_attentions, + output_hidden_states=output_hidden_states, + return_dict=return_dict, + ) + sequence_output = encoder_outputs[0] + pooled_output = self.pooler(sequence_output) if self.pooler is not None else None + + if not return_dict: + return (sequence_output, pooled_output) + encoder_outputs[1:] + + return BaseModelOutputWithPoolingAndCrossAttentions( + last_hidden_state=sequence_output, + pooler_output=pooled_output, + past_key_values=encoder_outputs.past_key_values, + hidden_states=encoder_outputs.hidden_states, + attentions=encoder_outputs.attentions, + cross_attentions=encoder_outputs.cross_attentions, + ) + + +@add_start_docstrings("""ESM Model with a `language modeling` head on top.""", ESM_START_DOCSTRING) +class EsmForMaskedLM(EsmPreTrainedModel): + _keys_to_ignore_on_save = [r"lm_head.decoder.weight", r"lm_head.decoder.bias"] + _keys_to_ignore_on_load_missing = [r"position_ids", r"lm_head.decoder.weight", r"lm_head.decoder.bias"] + _keys_to_ignore_on_load_unexpected = [r"pooler"] + + def __init__(self, config): + super().__init__(config) + + if config.is_decoder: + logger.warning( + "If you want to use `EsmForMaskedLM` make sure `config.is_decoder=False` for " + "bi-directional self-attention." + ) + + self.esm = EsmModel(config, add_pooling_layer=False) + self.lm_head = EsmLMHead(config) + + # The LM head weights require special treatment only when they are tied with the word embeddings + self.update_keys_to_ignore(config, ["lm_head.decoder.weight"]) + + self.init_weights() + + def get_output_embeddings(self): + return self.lm_head.decoder + + def set_output_embeddings(self, new_embeddings): + self.lm_head.decoder = new_embeddings + + @add_start_docstrings_to_model_forward(ESM_INPUTS_DOCSTRING.format("batch_size, sequence_length")) + @add_code_sample_docstrings( + processor_class=_TOKENIZER_FOR_DOC, + checkpoint=_CHECKPOINT_FOR_DOC, + output_type=MaskedLMOutput, + config_class=_CONFIG_FOR_DOC, + mask="", + ) + def forward( + self, + input_ids=None, + attention_mask=None, + position_ids=None, + head_mask=None, + inputs_embeds=None, + encoder_hidden_states=None, + encoder_attention_mask=None, + labels=None, + output_attentions=None, + output_hidden_states=None, + return_dict=None, + ): + r""" + labels (`torch.LongTensor` of shape `(batch_size, sequence_length)`, *optional*): + Labels for computing the masked language modeling loss. Indices should be in `[-100, 0, ..., + config.vocab_size]` (see `input_ids` docstring) Tokens with indices set to `-100` are ignored (masked), the + loss is only computed for the tokens with labels in `[0, ..., config.vocab_size]` + kwargs (`Dict[str, any]`, optional, defaults to *{}*): + Used to hide legacy arguments that have been deprecated. + """ + return_dict = return_dict if return_dict is not None else self.config.use_return_dict + + outputs = self.esm( + input_ids, + attention_mask=attention_mask, + position_ids=position_ids, + head_mask=head_mask, + inputs_embeds=inputs_embeds, + encoder_hidden_states=encoder_hidden_states, + encoder_attention_mask=encoder_attention_mask, + output_attentions=output_attentions, + output_hidden_states=output_hidden_states, + return_dict=return_dict, + ) + sequence_output = outputs[0] + prediction_scores = self.lm_head(sequence_output) + + masked_lm_loss = None + if labels is not None: + loss_fct = CrossEntropyLoss() + masked_lm_loss = loss_fct(prediction_scores.view(-1, self.config.vocab_size), labels.view(-1)) + + if not return_dict: + output = (prediction_scores,) + outputs[2:] + return ((masked_lm_loss,) + output) if masked_lm_loss is not None else output + + return MaskedLMOutput( + loss=masked_lm_loss, + logits=prediction_scores, + hidden_states=outputs.hidden_states, + attentions=outputs.attentions, + ) + + +class EsmLMHead(nn.Module): + """ESM Head for masked language modeling.""" + + def __init__(self, config): + super().__init__() + self.dense = nn.Linear(config.hidden_size, config.hidden_size) + self.layer_norm = nn.LayerNorm(config.hidden_size, eps=config.layer_norm_eps) + + self.decoder = nn.Linear(config.hidden_size, config.vocab_size, bias=False) + self.bias = nn.Parameter(torch.zeros(config.vocab_size)) + + # Need a link between the two variables so that the bias is correctly resized with `resize_token_embeddings` + self.decoder.bias = self.bias + + def forward(self, features, **kwargs): + x = self.dense(features) + x = gelu(x) + x = self.layer_norm(x) + + # project back to size of vocabulary with bias + x = self.decoder(x) + + return x + + +@add_start_docstrings( + """ + ESM Model transformer with a sequence classification/regression head on top (a linear layer on top of the pooled + output) e.g. for GLUE tasks. + """, + ESM_START_DOCSTRING, +) +class EsmForSequenceClassification(EsmPreTrainedModel): + _keys_to_ignore_on_load_missing = [r"position_ids"] + + def __init__(self, config): + super().__init__(config) + self.num_labels = config.num_labels + self.config = config + + self.esm = EsmModel(config, add_pooling_layer=False) + self.classifier = EsmClassificationHead(config) + + self.init_weights() + + @add_start_docstrings_to_model_forward(ESM_INPUTS_DOCSTRING.format("batch_size, sequence_length")) + @add_code_sample_docstrings( + processor_class=_TOKENIZER_FOR_DOC, + checkpoint=_CHECKPOINT_FOR_DOC, + output_type=SequenceClassifierOutput, + config_class=_CONFIG_FOR_DOC, + ) + def forward( + self, + input_ids=None, + attention_mask=None, + position_ids=None, + head_mask=None, + inputs_embeds=None, + labels=None, + output_attentions=None, + output_hidden_states=None, + return_dict=None, + ): + r""" + labels (`torch.LongTensor` of shape `(batch_size,)`, *optional*): + Labels for computing the sequence classification/regression loss. Indices should be in `[0, ..., + config.num_labels - 1]`. If `config.num_labels == 1` a regression loss is computed (Mean-Square loss), If + `config.num_labels > 1` a classification loss is computed (Cross-Entropy). + """ + return_dict = return_dict if return_dict is not None else self.config.use_return_dict + + outputs = self.esm( + input_ids, + attention_mask=attention_mask, + position_ids=position_ids, + head_mask=head_mask, + inputs_embeds=inputs_embeds, + output_attentions=output_attentions, + output_hidden_states=output_hidden_states, + return_dict=return_dict, + ) + sequence_output = outputs[0] + logits = self.classifier(sequence_output) + + loss = None + if labels is not None: + if self.config.problem_type is None: + if self.num_labels == 1: + self.config.problem_type = "regression" + elif self.num_labels > 1 and (labels.dtype == torch.long or labels.dtype == torch.int): + self.config.problem_type = "single_label_classification" + else: + self.config.problem_type = "multi_label_classification" + + if self.config.problem_type == "regression": + loss_fct = MSELoss() + if self.num_labels == 1: + loss = loss_fct(logits.squeeze(), labels.squeeze()) + else: + loss = loss_fct(logits, labels) + elif self.config.problem_type == "single_label_classification": + loss_fct = CrossEntropyLoss() + loss = loss_fct(logits.view(-1, self.num_labels), labels.view(-1)) + elif self.config.problem_type == "multi_label_classification": + loss_fct = BCEWithLogitsLoss() + loss = loss_fct(logits, labels) + + if not return_dict: + output = (logits,) + outputs[2:] + return ((loss,) + output) if loss is not None else output + + return SequenceClassifierOutput( + loss=loss, + logits=logits, + hidden_states=outputs.hidden_states, + attentions=outputs.attentions, + ) + + +@add_start_docstrings( + """ + ESM Model with a token classification head on top (a linear layer on top of the hidden-states output) e.g. for + Named-Entity-Recognition (NER) tasks. + """, + ESM_START_DOCSTRING, +) +class EsmForTokenClassification(EsmPreTrainedModel): + _keys_to_ignore_on_load_unexpected = [r"pooler"] + _keys_to_ignore_on_load_missing = [r"position_ids"] + + def __init__(self, config): + super().__init__(config) + self.num_labels = config.num_labels + + self.esm = EsmModel(config, add_pooling_layer=False) + self.dropout = nn.Dropout(config.hidden_dropout_prob) + self.classifier = nn.Linear(config.hidden_size, config.num_labels) + + self.init_weights() + + @add_start_docstrings_to_model_forward(ESM_INPUTS_DOCSTRING.format("batch_size, sequence_length")) + @add_code_sample_docstrings( + processor_class=_TOKENIZER_FOR_DOC, + checkpoint=_CHECKPOINT_FOR_DOC, + output_type=TokenClassifierOutput, + config_class=_CONFIG_FOR_DOC, + ) + def forward( + self, + input_ids=None, + attention_mask=None, + position_ids=None, + head_mask=None, + inputs_embeds=None, + labels=None, + output_attentions=None, + output_hidden_states=None, + return_dict=None, + ): + r""" + labels (`torch.LongTensor` of shape `(batch_size, sequence_length)`, *optional*): + Labels for computing the token classification loss. Indices should be in `[0, ..., config.num_labels - 1]`. + """ + return_dict = return_dict if return_dict is not None else self.config.use_return_dict + + outputs = self.esm( + input_ids, + attention_mask=attention_mask, + position_ids=position_ids, + head_mask=head_mask, + inputs_embeds=inputs_embeds, + output_attentions=output_attentions, + output_hidden_states=output_hidden_states, + return_dict=return_dict, + ) + + sequence_output = outputs[0] + + sequence_output = self.dropout(sequence_output) + logits = self.classifier(sequence_output) + + loss = None + if labels is not None: + loss_fct = CrossEntropyLoss() + # Only keep active parts of the loss + if attention_mask is not None: + active_loss = attention_mask.view(-1) == 1 + active_logits = logits.view(-1, self.num_labels) + active_labels = torch.where( + active_loss, labels.view(-1), torch.tensor(loss_fct.ignore_index).type_as(labels) + ) + loss = loss_fct(active_logits, active_labels) + else: + loss = loss_fct(logits.view(-1, self.num_labels), labels.view(-1)) + + if not return_dict: + output = (logits,) + outputs[2:] + return ((loss,) + output) if loss is not None else output + + return TokenClassifierOutput( + loss=loss, + logits=logits, + hidden_states=outputs.hidden_states, + attentions=outputs.attentions, + ) + + +class EsmClassificationHead(nn.Module): + """Head for sentence-level classification tasks.""" + + def __init__(self, config): + super().__init__() + self.dense = nn.Linear(config.hidden_size, config.hidden_size) + self.dropout = nn.Dropout(config.hidden_dropout_prob) + self.out_proj = nn.Linear(config.hidden_size, config.num_labels) + + def forward(self, features, **kwargs): + x = features[:, 0, :] # take token (equiv. to [CLS]) + x = self.dropout(x) + x = self.dense(x) + x = torch.tanh(x) + x = self.dropout(x) + x = self.out_proj(x) + return x + + +def create_position_ids_from_input_ids(input_ids, padding_idx, past_key_values_length=0): + """ + Replace non-padding symbols with their position numbers. Position numbers begin at padding_idx+1. Padding symbols + are ignored. This is modified from fairseq's `utils.make_positions`. + + Args: + x: torch.Tensor x: + + Returns: torch.Tensor + """ + # The series of casts and type-conversions here are carefully balanced to both work with ONNX export and XLA. + mask = input_ids.ne(padding_idx).int() + incremental_indices = (torch.cumsum(mask, dim=1).type_as(mask) + past_key_values_length) * mask + return incremental_indices.long() + padding_idx diff --git a/src/transformers/models/esm/tokenization_esm.py b/src/transformers/models/esm/tokenization_esm.py new file mode 100644 index 0000000000..0512ccf864 --- /dev/null +++ b/src/transformers/models/esm/tokenization_esm.py @@ -0,0 +1,106 @@ +# coding=utf-8 +# Copyright Facebook and The HuggingFace Inc. team. All rights reserved. +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. +"""Tokenization classes for ESM.""" +import os +from typing import List, Optional, Union + +from ...tokenization_utils import PreTrainedTokenizer +from ...tokenization_utils_base import AddedToken +from ...utils import logging + + +logger = logging.get_logger(__name__) + +VOCAB_FILES_NAMES = {"vocab_file": "vocab.txt"} + +PRETRAINED_VOCAB_FILES_MAP = { + "vocab_file": { + "facebook/esm1b": "https://huggingface.co/facebook/esm1b/resolve/main/vocab.txt", + }, +} + +PRETRAINED_POSITIONAL_EMBEDDINGS_SIZES = { + "facebook/esm1b": 1024, +} + + +def load_vocab_file(vocab_file): + with open(vocab_file, "r") as f: + lines = f.read().splitlines() + return [l.strip() for l in lines] + + +class EsmTokenizer(PreTrainedTokenizer): + """ + Constructs an ESM tokenizer. + """ + + vocab_files_names = VOCAB_FILES_NAMES + pretrained_vocab_files_map = PRETRAINED_VOCAB_FILES_MAP + max_model_input_sizes = PRETRAINED_POSITIONAL_EMBEDDINGS_SIZES + model_input_names = ["input_ids", "attention_mask"] + + def __init__(self, vocab_file, **kwargs): + super().__init__(**kwargs) + self.all_tokens = load_vocab_file(vocab_file) + self._id_to_token = {ind: tok for ind, tok in enumerate(self.all_tokens)} + self._token_to_id = {tok: ind for ind, tok in enumerate(self.all_tokens)} + self.unk_token = "" + self.cls_token = "" + self.pad_token = "" + self.mask_token = "" + self.eos_token = "" + self.unique_no_split_tokens = self.all_tokens + self._create_trie(self.unique_no_split_tokens) + + def _convert_id_to_token(self, index: int) -> str: + return self._id_to_token.get(index, self.unk_token) + + def _convert_token_to_id(self, token: str) -> int: + return self._token_to_id.get(token, self._token_to_id.get(self.unk_token)) + + def _tokenize(self, text, **kwargs): + return text.split() + + def get_vocab_size(self, with_added_tokens=False): + return len(self._id_to_token) + + def token_to_id(self, token: str) -> int: + return self._token_to_id.get(token, self._token_to_id.get(self.unk_token)) + + def id_to_token(self, index: int) -> str: + return self._id_to_token.get(index, self.unk_token) + + def build_inputs_with_special_tokens( + self, token_ids_0: List[int], token_ids_1: Optional[List[int]] = None + ) -> List[int]: + if token_ids_1 is not None: + raise ValueError("Multiple input sentences are not supported!") + cls_: List[int] = [self.cls_token_id] + eos_: List[int] = [self.eos_token_id] + return cls_ + token_ids_0 + eos_ + + def save_vocabulary(self, save_directory, filename_prefix): + vocab_file = os.path.join(save_directory, (filename_prefix + "-" if filename_prefix else "") + "vocab.txt") + with open(vocab_file, "w") as f: + f.write("\n".join(self.all_tokens)) + return (vocab_file,) + + @property + def vocab_size(self) -> int: + return self.get_vocab_size(with_added_tokens=False) + + def _add_tokens(self, new_tokens: Union[List[str], List[AddedToken]], special_tokens: bool = False) -> int: + return super()._add_tokens(new_tokens, special_tokens=True) diff --git a/src/transformers/utils/dummy_pt_objects.py b/src/transformers/utils/dummy_pt_objects.py index d564c08e9f..769cc4c4b3 100644 --- a/src/transformers/utils/dummy_pt_objects.py +++ b/src/transformers/utils/dummy_pt_objects.py @@ -1948,6 +1948,44 @@ class ErniePreTrainedModel(metaclass=DummyObject): requires_backends(self, ["torch"]) +ESM_PRETRAINED_MODEL_ARCHIVE_LIST = None + + +class EsmForMaskedLM(metaclass=DummyObject): + _backends = ["torch"] + + def __init__(self, *args, **kwargs): + requires_backends(self, ["torch"]) + + +class EsmForSequenceClassification(metaclass=DummyObject): + _backends = ["torch"] + + def __init__(self, *args, **kwargs): + requires_backends(self, ["torch"]) + + +class EsmForTokenClassification(metaclass=DummyObject): + _backends = ["torch"] + + def __init__(self, *args, **kwargs): + requires_backends(self, ["torch"]) + + +class EsmModel(metaclass=DummyObject): + _backends = ["torch"] + + def __init__(self, *args, **kwargs): + requires_backends(self, ["torch"]) + + +class EsmPreTrainedModel(metaclass=DummyObject): + _backends = ["torch"] + + def __init__(self, *args, **kwargs): + requires_backends(self, ["torch"]) + + FLAUBERT_PRETRAINED_MODEL_ARCHIVE_LIST = None diff --git a/tests/models/esm/__init__.py b/tests/models/esm/__init__.py new file mode 100644 index 0000000000..e69de29bb2 diff --git a/tests/models/esm/test_modeling_esm.py b/tests/models/esm/test_modeling_esm.py new file mode 100644 index 0000000000..7bd0a36c8b --- /dev/null +++ b/tests/models/esm/test_modeling_esm.py @@ -0,0 +1,293 @@ +# coding=utf-8 +# Copyright 2022 The HuggingFace Inc. team. All rights reserved. +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. +""" Testing suite for the PyTorch ESM model. """ + + +import unittest + +from transformers import EsmConfig, is_torch_available +from transformers.testing_utils import TestCasePlus, require_torch, slow, torch_device + +from ...generation.test_generation_utils import GenerationTesterMixin +from ...test_configuration_common import ConfigTester +from ...test_modeling_common import ModelTesterMixin, ids_tensor, random_attention_mask + + +if is_torch_available(): + import torch + + from transformers import EsmForMaskedLM, EsmForSequenceClassification, EsmForTokenClassification, EsmModel + from transformers.models.esm.modeling_esm import ( + ESM_PRETRAINED_MODEL_ARCHIVE_LIST, + EsmEmbeddings, + create_position_ids_from_input_ids, + ) + + +# copied from tests.test_modeling_roberta +class EsmModelTester: + def __init__( + self, + parent, + ): + self.parent = parent + self.batch_size = 13 + self.seq_length = 7 + self.is_training = False + self.use_input_mask = True + self.use_token_type_ids = False + self.use_labels = True + self.vocab_size = 99 + self.hidden_size = 32 + self.num_hidden_layers = 5 + self.num_attention_heads = 4 + self.intermediate_size = 37 + self.hidden_act = "gelu" + self.hidden_dropout_prob = 0.1 + self.attention_probs_dropout_prob = 0.1 + self.max_position_embeddings = 512 + self.type_vocab_size = 16 + self.type_sequence_label_size = 2 + self.initializer_range = 0.02 + self.num_labels = 3 + self.num_choices = 4 + self.scope = None + + def prepare_config_and_inputs(self): + input_ids = ids_tensor([self.batch_size, self.seq_length], self.vocab_size) + + input_mask = None + if self.use_input_mask: + input_mask = random_attention_mask([self.batch_size, self.seq_length]) + + sequence_labels = None + token_labels = None + choice_labels = None + if self.use_labels: + sequence_labels = ids_tensor([self.batch_size], self.type_sequence_label_size) + token_labels = ids_tensor([self.batch_size, self.seq_length], self.num_labels) + choice_labels = ids_tensor([self.batch_size], self.num_choices) + + config = self.get_config() + + return config, input_ids, input_mask, sequence_labels, token_labels, choice_labels + + def get_config(self): + return EsmConfig( + vocab_size=self.vocab_size, + hidden_size=self.hidden_size, + pad_token_id=1, + num_hidden_layers=self.num_hidden_layers, + num_attention_heads=self.num_attention_heads, + intermediate_size=self.intermediate_size, + hidden_act=self.hidden_act, + hidden_dropout_prob=self.hidden_dropout_prob, + attention_probs_dropout_prob=self.attention_probs_dropout_prob, + max_position_embeddings=self.max_position_embeddings, + type_vocab_size=self.type_vocab_size, + initializer_range=self.initializer_range, + ) + + def create_and_check_model(self, config, input_ids, input_mask, sequence_labels, token_labels, choice_labels): + model = EsmModel(config=config) + model.to(torch_device) + model.eval() + result = model(input_ids, attention_mask=input_mask) + result = model(input_ids) + result = model(input_ids) + + self.parent.assertEqual(result.last_hidden_state.shape, (self.batch_size, self.seq_length, self.hidden_size)) + self.parent.assertEqual(result.pooler_output.shape, (self.batch_size, self.hidden_size)) + + def create_and_check_for_masked_lm( + self, config, input_ids, input_mask, sequence_labels, token_labels, choice_labels + ): + model = EsmForMaskedLM(config=config) + model.to(torch_device) + model.eval() + result = model(input_ids, attention_mask=input_mask, labels=token_labels) + self.parent.assertEqual(result.logits.shape, (self.batch_size, self.seq_length, self.vocab_size)) + + def create_and_check_for_token_classification( + self, config, input_ids, input_mask, sequence_labels, token_labels, choice_labels + ): + config.num_labels = self.num_labels + model = EsmForTokenClassification(config=config) + model.to(torch_device) + model.eval() + result = model(input_ids, attention_mask=input_mask, labels=token_labels) + self.parent.assertEqual(result.logits.shape, (self.batch_size, self.seq_length, self.num_labels)) + + def prepare_config_and_inputs_for_common(self): + config_and_inputs = self.prepare_config_and_inputs() + ( + config, + input_ids, + input_mask, + sequence_labels, + token_labels, + choice_labels, + ) = config_and_inputs + inputs_dict = {"input_ids": input_ids, "attention_mask": input_mask} + return config, inputs_dict + + +@require_torch +class EsmModelTest(ModelTesterMixin, GenerationTesterMixin, unittest.TestCase): + + test_mismatched_shapes = False + + all_model_classes = ( + ( + EsmForMaskedLM, + EsmModel, + EsmForSequenceClassification, + EsmForTokenClassification, + ) + if is_torch_available() + else () + ) + all_generative_model_classes = () + test_sequence_classification_problem_types = True + + def setUp(self): + self.model_tester = EsmModelTester(self) + self.config_tester = ConfigTester(self, config_class=EsmConfig, hidden_size=37) + + def test_config(self): + self.config_tester.run_common_tests() + + def test_model(self): + config_and_inputs = self.model_tester.prepare_config_and_inputs() + self.model_tester.create_and_check_model(*config_and_inputs) + + def test_model_various_embeddings(self): + config_and_inputs = self.model_tester.prepare_config_and_inputs() + for type in ["absolute", "relative_key", "relative_key_query"]: + config_and_inputs[0].position_embedding_type = type + self.model_tester.create_and_check_model(*config_and_inputs) + + def test_for_masked_lm(self): + config_and_inputs = self.model_tester.prepare_config_and_inputs() + self.model_tester.create_and_check_for_masked_lm(*config_and_inputs) + + def test_for_token_classification(self): + config_and_inputs = self.model_tester.prepare_config_and_inputs() + self.model_tester.create_and_check_for_token_classification(*config_and_inputs) + + @slow + def test_model_from_pretrained(self): + for model_name in ESM_PRETRAINED_MODEL_ARCHIVE_LIST[:1]: + model = EsmModel.from_pretrained(model_name) + self.assertIsNotNone(model) + + def test_create_position_ids_respects_padding_index(self): + """Ensure that the default position ids only assign a sequential . This is a regression + test for https://github.com/huggingface/transformers/issues/1761 + + The position ids should be masked with the embedding object's padding index. Therefore, the + first available non-padding position index is EsmEmbeddings.padding_idx + 1 + """ + config = self.model_tester.prepare_config_and_inputs()[0] + model = EsmEmbeddings(config=config) + + input_ids = torch.as_tensor([[12, 31, 13, model.padding_idx]]) + expected_positions = torch.as_tensor( + [ + [ + 0 + model.padding_idx + 1, + 1 + model.padding_idx + 1, + 2 + model.padding_idx + 1, + model.padding_idx, + ] + ] + ) + position_ids = create_position_ids_from_input_ids(input_ids, model.padding_idx) + self.assertEqual(position_ids.shape, expected_positions.shape) + self.assertTrue(torch.all(torch.eq(position_ids, expected_positions))) + + def test_create_position_ids_from_inputs_embeds(self): + """Ensure that the default position ids only assign a sequential . This is a regression + test for https://github.com/huggingface/transformers/issues/1761 + + The position ids should be masked with the embedding object's padding index. Therefore, the + first available non-padding position index is EsmEmbeddings.padding_idx + 1 + """ + config = self.model_tester.prepare_config_and_inputs()[0] + embeddings = EsmEmbeddings(config=config) + + inputs_embeds = torch.empty(2, 4, 30) + expected_single_positions = [ + 0 + embeddings.padding_idx + 1, + 1 + embeddings.padding_idx + 1, + 2 + embeddings.padding_idx + 1, + 3 + embeddings.padding_idx + 1, + ] + expected_positions = torch.as_tensor([expected_single_positions, expected_single_positions]) + position_ids = embeddings.create_position_ids_from_inputs_embeds(inputs_embeds) + self.assertEqual(position_ids.shape, expected_positions.shape) + self.assertTrue(torch.all(torch.eq(position_ids, expected_positions))) + + +@require_torch +class EsmModelIntegrationTest(TestCasePlus): + @slow + def test_inference_masked_lm(self): + model = EsmForMaskedLM.from_pretrained("Rocketknight1/esm-2-8m") + input_ids = torch.tensor([[0, 1, 2, 3, 4, 5]]) + output = model(input_ids)[0] + + vocab_size = 33 + + expected_shape = torch.Size((1, 6, vocab_size)) + self.assertEqual(output.shape, expected_shape) + + expected_slice = torch.tensor( + [[[15.0973, -6.6406, -1.1351], [-0.2209, -9.9622, 4.2109], [-1.6055, -10.0023, 1.5914]]] + ) + self.assertTrue(torch.allclose(output[:, :3, :3], expected_slice, atol=1e-4)) + + @slow + def test_inference_no_head(self): + model = EsmModel.from_pretrained("Rocketknight1/esm-2-8m") + + input_ids = torch.tensor([[0, 6, 4, 13, 5, 4, 16, 12, 11, 7, 2]]) + output = model(input_ids)[0] + # compare the actual values for a slice. + expected_slice = torch.tensor( + [[[0.1444, 0.5413, 0.3248], [0.3034, 0.0053, 0.3108], [0.3228, -0.2499, 0.3415]]] + ) + self.assertTrue(torch.allclose(output[:, :3, :3], expected_slice, atol=1e-4)) + + def test_lm_head_ignore_keys(self): + from copy import deepcopy + + keys_to_ignore_on_save_tied = [r"lm_head.decoder.weight", r"lm_head.decoder.bias"] + keys_to_ignore_on_save_untied = [r"lm_head.decoder.bias"] + config = EsmConfig.from_pretrained("Rocketknight1/esm-2-8m") + config_tied = deepcopy(config) + config_tied.tie_word_embeddings = True + config_untied = deepcopy(config) + config_untied.tie_word_embeddings = False + for cls in [EsmForMaskedLM]: + model = cls(config_tied) + self.assertEqual(model._keys_to_ignore_on_save, keys_to_ignore_on_save_tied, cls) + + # the keys should be different when embeddings aren't tied + model = cls(config_untied) + self.assertEqual(model._keys_to_ignore_on_save, keys_to_ignore_on_save_untied, cls) + + # test that saving works with updated ignore keys - just testing that it doesn't fail + model.save_pretrained(self.get_auto_remove_tmp_dir()) diff --git a/tests/models/esm/test_tokenization_esm.py b/tests/models/esm/test_tokenization_esm.py new file mode 100644 index 0000000000..242f6d7708 --- /dev/null +++ b/tests/models/esm/test_tokenization_esm.py @@ -0,0 +1,91 @@ +# coding=utf-8 +# Copyright 2021 The HuggingFace Team. All rights reserved. +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + + +import os +import tempfile +import unittest +from typing import List + +from transformers.models.esm.tokenization_esm import VOCAB_FILES_NAMES, EsmTokenizer +from transformers.testing_utils import require_tokenizers +from transformers.tokenization_utils import PreTrainedTokenizer +from transformers.tokenization_utils_base import PreTrainedTokenizerBase + + +@require_tokenizers +class ESMTokenizationTest(unittest.TestCase): + tokenizer_class = EsmTokenizer + + def setUp(self): + super().setUp() + self.tmpdirname = tempfile.mkdtemp() + # fmt: off + vocab_tokens: List[str] = ["", "", "", "", "L", "A", "G", "V", "S", "E", "R", "T", "I", "D", "P", "K", "Q", "N", "F", "Y", "M", "H", "W", "C", "X", "B", "U", "Z", "O", ".", "-", "", ""] # noqa: E501 + # fmt: on + self.vocab_file = os.path.join(self.tmpdirname, VOCAB_FILES_NAMES["vocab_file"]) + with open(self.vocab_file, "w", encoding="utf-8") as vocab_writer: + vocab_writer.write("".join([x + "\n" for x in vocab_tokens])) + + def get_tokenizers(self, **kwargs) -> List[PreTrainedTokenizerBase]: + return [self.get_tokenizer(**kwargs)] + + def get_tokenizer(self, **kwargs) -> PreTrainedTokenizer: + return self.tokenizer_class.from_pretrained(self.tmpdirname, **kwargs) + + def test_tokenizer_single_example(self): + tokenizer = self.tokenizer_class(self.vocab_file) + + tokens = tokenizer.tokenize("LAGVS") + self.assertListEqual(tokens, ["L", "A", "G", "V", "S"]) + self.assertListEqual(tokenizer.convert_tokens_to_ids(tokens), [4, 5, 6, 7, 8]) + + def test_tokenizer_encode_single(self): + tokenizer = self.tokenizer_class(self.vocab_file) + + seq = "LAGVS" + self.assertListEqual(tokenizer.encode(seq), [0, 4, 5, 6, 7, 8, 2]) + + def test_tokenizer_call_no_pad(self): + tokenizer = self.tokenizer_class(self.vocab_file) + + seq_batch = ["LAGVS", "WCB"] + tokens_batch = tokenizer(seq_batch, padding=False)["input_ids"] + + self.assertListEqual(tokens_batch, [[0, 4, 5, 6, 7, 8, 2], [0, 22, 23, 25, 2]]) + + def test_tokenizer_call_pad(self): + tokenizer = self.tokenizer_class(self.vocab_file) + + seq_batch = ["LAGVS", "WCB"] + tokens_batch = tokenizer(seq_batch, padding=True)["input_ids"] + + self.assertListEqual(tokens_batch, [[0, 4, 5, 6, 7, 8, 2], [0, 22, 23, 25, 2, 1, 1]]) + + def test_tokenize_special_tokens(self): + """Test `tokenize` with special tokens.""" + tokenizers = self.get_tokenizers(fast=True) + for tokenizer in tokenizers: + with self.subTest(f"{tokenizer.__class__.__name__}"): + SPECIAL_TOKEN_1 = "" + SPECIAL_TOKEN_2 = "" + + token_1 = tokenizer.tokenize(SPECIAL_TOKEN_1) + token_2 = tokenizer.tokenize(SPECIAL_TOKEN_2) + + self.assertEqual(len(token_1), 1) + self.assertEqual(len(token_2), 1) + self.assertEqual(token_1[0], SPECIAL_TOKEN_1) + self.assertEqual(token_2[0], SPECIAL_TOKEN_2)